DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G59650

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200773.1 Gene:AT5G59650 / 836086 AraportID:AT5G59650 Length:892 Species:Arabidopsis thaliana


Alignment Length:339 Identity:95/339 - (28%)
Similarity:158/339 - (46%) Gaps:40/339 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NNNRTSTTATEEIPSLESLGNIHISTVQRAAES-LLEIDYAELENATDGWSPDNRLGQGGFGDVY 228
            :..::||....:.|.  |:..:|.::.:.:.|: .....|:|:...|:.:  ...:|:||||.|.
plant   542 SKKKSSTVGALQPPL--SMPMVHDNSPEPSIETKKRRFTYSEVIKMTNNF--QRVVGEGGFGVVC 602

  Fly   229 RGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYN----ELKYLNSIRHDNILALYGYSIKGGKPC 288
            .|.....: ||:||::..|          .|.|.    |:..|..:.|.|:::|.||..:.....
plant   603 HGTINGSEQVAVKVLSQSS----------SQGYKHFKAEVDLLLRVHHTNLVSLVGYCDERDHLA 657

  Fly   289 LVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANIL 353
            |:|:.:..|.|...|......:   .:.|..|..|:|..|.|:.:||:....|::|.|||..|||
plant   658 LIYEFLPKGDLRQHLSGKSGGS---FINWGNRLRIALEAALGLEYLHSGCTPPIVHRDIKTTNIL 719

  Fly   354 LDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVF 418
            ||:.|:.|:.||||.|..|...:..:. ..|.||..||.||:....:|....|||||||||||:.
plant   720 LDEQLKAKLADFGLSRSFPIGGETHIS-TVVAGTPGYLDPEYYQTTRLGEKSDVYSFGIVLLEII 783

  Fly   419 TGRQVTDRVPENETKKNLLDYVKQQW------RQNRMELLEKHLAAPMGKELDMCMCAIEAGLHC 477
            |.:.|.|   ::.:|.::     .||      |.:..::::.:|....  |.......:|..:.|
plant   784 TNQPVID---QSRSKSHI-----SQWVGFELTRGDITKIMDPNLNGDY--ESRSVWRVLELAMSC 838

  Fly   478 TALDPQDRPSMNAV 491
            ......:||:|:.|
plant   839 ANPSSVNRPNMSQV 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 86/284 (30%)
TyrKc 219..495 CDD:197581 86/284 (30%)
AT5G59650NP_200773.1 Malectin_like 32..353 CDD:289580
leucine-rich repeat 445..468 CDD:275380
leucine-rich repeat 469..489 CDD:275380
PKc_like 604..858 CDD:304357 80/273 (29%)
S_TKc 610..>787 CDD:214567 65/190 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.