DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G59270

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001330782.1 Gene:AT5G59270 / 836045 AraportID:AT5G59270 Length:687 Species:Arabidopsis thaliana


Alignment Length:358 Identity:113/358 - (31%)
Similarity:177/358 - (49%) Gaps:31/358 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPFPSSSGVSNSNNNRTSTTATEEIPSLESLGN-IHISTVQRAAESL--LEIDYA-------ELE 207
            ||.|.:|...:|.|..........|..|..||. :::...::.||.|  .|.:|:       .|.
plant   298 PPTPPTSRSKDSKNIIIICVTVTSIAFLLMLGGFLYLYKKKKYAEVLEHWENEYSPQRYSFRNLY 362

  Fly   208 NATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRH 271
            .|..|:..:..||.||||.||:|:... ..:|:|.:.:   |.:|.|   :|...|:..:..:||
plant   363 KAIRGFRENRLLGAGGFGKVYKGELPSGTQIAVKRVYH---NAEQGM---KQYAAEIASMGRLRH 421

  Fly   272 DNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHT 336
            .|::.|.||..:.|:..|||..|..|||:..|   ..:|.|..|||.||.:|..|.|..:.:||.
plant   422 KNLVQLLGYCRRKGELLLVYDYMPNGSLDDYL---FNKNKLKDLTWSQRVNIIKGVASALLYLHE 483

  Fly   337 ARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQL 401
            .....::|.|||.:|||||..|..::|||||.|...:..:  ::..:|.||..|:.||.......
plant   484 EWEQVVLHRDIKASNILLDADLNGRLGDFGLARFHDRGEN--LQATRVVGTIGYMAPELTAMGVA 546

  Fly   402 STGVDVYSFGIVLLEVFTGRQVT--DRVPENETKKNLLDYVKQ-QWRQNRMELLEKHLAAPMGKE 463
            :|..|:|:||..:|||..||:..  ||.||   :.:||.:|.. ..|...|::::..|.....||
plant   547 TTKTDIYAFGSFILEVVCGRRPVEPDRPPE---QMHLLKWVATCGKRDTLMDVVDSKLGDFKAKE 608

  Fly   464 LDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            ..:   .::.|:.|:..:|:.||||..:::..|
plant   609 AKL---LLKLGMLCSQSNPESRPSMRHIIQYLE 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 95/282 (34%)
TyrKc 219..495 CDD:197581 94/279 (34%)
AT5G59270NP_001330782.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.