DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G56890

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_680446.1 Gene:AT5G56890 / 835791 AraportID:AT5G56890 Length:1113 Species:Arabidopsis thaliana


Alignment Length:377 Identity:116/377 - (30%)
Similarity:177/377 - (46%) Gaps:50/377 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHIS 189
            |.|..|.:.|::..| :.|..||:...|..|.|:|                  .|.||    .|:
plant   661 LSKRTPLARPSLPSL-SKPSGSARSLTGSRFSSTS------------------LSFES----SIA 702

  Fly   190 TVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKM 253
            ....:|::...   :|:..||:.:.....||:||||.||.|.:.. ..||:||:.    ..||: 
plant   703 PFTLSAKTFTA---SEIMKATNNFDESRVLGEGGFGRVYEGVFDDGTKVAVKVLK----RDDQQ- 759

  Fly   254 VELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRA-HKAQNPLPALTW 317
             ..::...|::.|:.:.|.|::.|.|..|:.....|||:|:..||:|:.|.. .||.:|   |.|
plant   760 -GSREFLAEVEMLSRLHHRNLVNLIGICIEDRNRSLVYELIPNGSVESHLHGIDKASSP---LDW 820

  Fly   318 QQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN 382
            ..|..|:||.|||:.:||......:||.|.|.:||||:....||:.||||.|......|......
plant   821 DARLKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLENDFTPKVSDFGLARNALDDEDNRHIST 885

  Fly   383 KVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQN 447
            :|.||..|:.||:.....|....||||:|:||||:.|||:..| :.:...::||:     .|.:.
plant   886 RVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVD-MSQPPGQENLV-----SWTRP 944

  Fly   448 RMELLEKHLAA----PMGKELDMCMCAIEAGLHCTALDPQ--DRPSMNAVLK 493
            .:...| .|||    .:|.|:.....|..|.:....:.|:  .||.|..|::
plant   945 FLTSAE-GLAAIIDQSLGPEISFDSIAKVAAIASMCVQPEVSHRPFMGEVVQ 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 1/2 (50%)
STKc_IRAK 219..498 CDD:270968 96/283 (34%)
TyrKc 219..495 CDD:197581 96/283 (34%)
AT5G56890NP_680446.1 PHA03247 <46..425 CDD:223021
STKc_IRAK 729..998 CDD:270968 96/283 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.