DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G55830

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200394.1 Gene:AT5G55830 / 835677 AraportID:AT5G55830 Length:681 Species:Arabidopsis thaliana


Alignment Length:310 Identity:101/310 - (32%)
Similarity:156/310 - (50%) Gaps:24/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            |.|..|.||..||.|:.....:|:|.||:|||..:........|...|..:.:.|...|.    |
plant   350 LREFSYKELYTATKGFHSSRVIGRGAFGNVYRAMFVSSGTISAVKRSRHNSTEGKTEFLA----E 410

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGT 327
            |..:..:||.|::.|.|:..:.|:..|||:.|..|||: ::...::|....||.|..|.:|::|.
plant   411 LSIIACLRHKNLVQLQGWCNEKGELLLVYEFMPNGSLD-KILYQESQTGAVALDWSHRLNIAIGL 474

  Fly   328 ARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR--EGPKSLDAVVEVNKVFGTKIY 390
            |..:.:||......::|.|||.:||:||.....::|||||.|  |..||..:.:..    ||..|
plant   475 ASALSYLHHECEQQVVHRDIKTSNIMLDINFNARLGDFGLARLTEHDKSPVSTLTA----GTMGY 535

  Fly   391 LPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR----MEL 451
            |.||:..:...:...|.:|:|:|:|||..||:..|:.||::...||:|:|   ||.:.    :|.
plant   536 LAPEYLQYGTATEKTDAFSYGVVILEVACGRRPIDKEPESQKTVNLVDWV---WRLHSEGRVLEA 597

  Fly   452 LEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK----RFEP 497
            :::.|.....:|  |....:..||.|...|..:||||..||:    ..||
plant   598 VDERLKGEFDEE--MMKKLLLVGLKCAHPDSNERPSMRRVLQILNNEIEP 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/289 (32%)
TyrKc 219..495 CDD:197581 91/285 (32%)
AT5G55830NP_200394.1 lectin_legume_LecRK_Arcelin_ConA 32..268 CDD:173887
Pkinase 365..637 CDD:278497 90/285 (32%)
STKc_IRAK 371..641 CDD:270968 91/283 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.