DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK8

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_198672.1 Gene:PERK8 / 833844 AraportID:AT5G38560 Length:681 Species:Arabidopsis thaliana


Alignment Length:308 Identity:95/308 - (30%)
Similarity:147/308 - (47%) Gaps:35/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYL 266
            |.||...|.|:|..|.||:||||.||:|.... .:||:|.:.......:::...      |::.:
plant   329 YDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKA------EVEII 387

  Fly   267 NSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGI 331
            :.:.|.:::.|.||.|......|||..:...:|...|.|...    |.:||:.|..::.|.||||
plant   388 SRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGR----PVMTWETRVRVAAGAARGI 448

  Fly   332 YFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPEF 395
            .:||......:||.|||.:|||||...:..:.||||.:.. :.||....|: :|.||..|:.||:
plant   449 AYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIA-QELDLNTHVSTRVMGTFGYMAPEY 512

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRM----------E 450
            ....:||...||||:|::|||:.|||:..|      |.:.|.|....:|.:..:          |
plant   513 ATSGKLSEKADVYSYGVILLELITGRKPVD------TSQPLGDESLVEWARPLLGQAIENEEFDE 571

  Fly   451 LLEKHLAAPM--GKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            |::..|....  |:...|    :||...|.......||.|:.|::..:
plant   572 LVDPRLGKNFIPGEMFRM----VEAAAACVRHSAAKRPKMSQVVRALD 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 88/292 (30%)
TyrKc 219..495 CDD:197581 88/289 (30%)
PERK8NP_198672.1 STKc_IRAK 345..617 CDD:270968 88/292 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.