DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G37450

DIOPT Version :10

Sequence 1:NP_476971.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001332712.1 Gene:AT5G37450 / 833722 AraportID:AT5G37450 Length:983 Species:Arabidopsis thaliana


Alignment Length:310 Identity:101/310 - (32%)
Similarity:165/310 - (53%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWK-QLDVAIKVMNYRSPNIDQKMVELQQS 259
            ||:...::.||::||..:|..:::|:||:|.||:|... .|.||:|       ..:|..::.|:.
plant   638 ESVKGYNFTELDSATSSFSDLSQIGRGGYGKVYKGHLPGGLVVAVK-------RAEQGSLQGQKE 695

  Fly   260 -YNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSI 323
             :.|::.|:.:.|.|:::|.||..:.|:..|||:.|..|||:..|.|...|    .|:...|..|
plant   696 FFTEIELLSRLHHRNLVSLLGYCDQKGEQMLVYEYMPNGSLQDALSARFRQ----PLSLALRLRI 756

  Fly   324 SLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR-----EGPKSLDAVVEVNK 383
            :||:||||.:|||....|:||.||||:|||||..:.||:.|||:.:     .|....|.|..:.|
plant   757 ALGSARGILYLHTEADPPIIHRDIKPSNILLDSKMNPKVADFGISKLIALDGGGVQRDHVTTIVK 821

  Fly   384 VFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQN- 447
              ||..|:.||:....:|:...||||.|||.||:.||.:....      .:|::..|.:..... 
plant   822 --GTPGYVDPEYYLSHRLTEKSDVYSLGIVFLEILTGMRPISH------GRNIVREVNEACDAGM 878

  Fly   448 RMELLEKHLAAPMGKELDMCMCA-IEAGLHCTALDPQDRPSMNAVLKRFE 496
            .|.::::    .||:..:.|:.. :|..:.|...:|:.||.|..:::..|
plant   879 MMSVIDR----SMGQYSEECVKRFMELAIRCCQDNPEARPWMLEIVRELE 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_476971.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 94/287 (33%)
AT5G37450NP_001332712.1 PLN00113 61..925 CDD:215061 101/310 (33%)
leucine-rich repeat 82..102 CDD:275380
leucine-rich repeat 103..126 CDD:275380
leucine-rich repeat 127..150 CDD:275380
leucine-rich repeat 151..174 CDD:275380
leucine-rich repeat 175..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
leucine-rich repeat 223..247 CDD:275380
leucine-rich repeat 248..269 CDD:275380
leucine-rich repeat 271..293 CDD:275380
leucine-rich repeat 294..317 CDD:275380
STKc_IRAK 661..926 CDD:270968 94/287 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.