DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and ANX2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001318669.1 Gene:ANX2 / 832975 AraportID:AT5G28680 Length:858 Species:Arabidopsis thaliana


Alignment Length:362 Identity:120/362 - (33%)
Similarity:182/362 - (50%) Gaps:48/362 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSP 215
            :|....:||.:....|:.||  ||:...|.:|....|:|.:  ||........:|:::.|..:..
plant   463 SGSDSHTSSWLPIYGNSHTS--ATKSTISGKSNNGSHLSNL--AAGLCRRFSLSEIKHGTHNFDE 523

  Fly   216 DNRLGQGGFGDVYRGKWKQLD----VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILA 276
            .|.:|.||||.||:|   .:|    ||||..|   ||.:|.:.|.:   .|::.|:.:||.::::
plant   524 SNVIGVGGFGKVYKG---VIDGGTKVAIKKSN---PNSEQGLNEFE---TEIELLSRLRHKHLVS 579

  Fly   277 LYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTP 341
            |.||..:||:.||:|..|..|:    ||.|......|.|||::|..|::|.|||:::|||.....
plant   580 LIGYCDEGGEMCLIYDYMSLGT----LREHLYNTKRPQLTWKRRLEIAIGAARGLHYLHTGAKYT 640

  Fly   342 LIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVE--VNKVFGTKIYLPPEFRNFRQLSTG 404
            :||.|:|..|||||:....|:.||||.:.||......|.  |...||   ||.||:...:||:..
plant   641 IIHRDVKTTNILLDENWVAKVSDFGLSKTGPNMNGGHVTTVVKGSFG---YLDPEYFRRQQLTEK 702

  Fly   405 VDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRME-LLEKHLAAPMGKELDMCM 468
            .||||||:||.||...|...:.....| :.:|.|:.....|:..:| :::.:|...:..|   |:
plant   703 SDVYSFGVVLFEVLCARPALNPSLSKE-QVSLGDWAMNCKRKGTLEDIIDPNLKGKINPE---CL 763

  Fly   469 ---------CAIEAGLHCTALDPQDRPSMNAVLKRFE 496
                     |..::||        |||:|..||...|
plant   764 KKFADTAEKCLSDSGL--------DRPTMGDVLWNLE 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 103/294 (35%)
TyrKc 219..495 CDD:197581 102/291 (35%)
ANX2NP_001318669.1 Malectin_like 32..399 CDD:289580
Malectin 213..367 CDD:288557
STYKc 526..788 CDD:214568 100/289 (35%)
STKc_IRAK 527..792 CDD:270968 102/292 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.