DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G24100

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197798.1 Gene:AT5G24100 / 832475 AraportID:AT5G24100 Length:614 Species:Arabidopsis thaliana


Alignment Length:447 Identity:104/447 - (23%)
Similarity:174/447 - (38%) Gaps:74/447 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PDQVEQISSQKQRGRSASN-EFLNIWGGQYNHTVQTLFALFKKLKLHNAMRLIKDYVSEDLHKYI 129
            |..|.....||:.|...|. ..|.|       .:...|.:|..:    |:.:|..||.....   
plant   231 PPAVVSFKEQKKNGIYISEPAILGI-------AISVCFVIFFVI----AVVIIVCYVKRQRK--- 281

  Fly   130 PRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRA 194
                   ||....||   |:......||...||.....:.    .|::.....:..:........
plant   282 -------SETEPKPD---KLKLAKKMPSEKEVSKLGKEKN----IEDMEDKSEINKVMFFEGSNL 332

  Fly   195 AESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDV-AIKVMNYRSPNIDQKMVELQQ 258
            |.:|.::..|..|          .||:|.||..|:...:...| |:|       .:...:|..:.
plant   333 AFNLEDLLIASAE----------FLGKGVFGMTYKAVLEDSKVIAVK-------RLKDIVVSRKD 380

  Fly   259 SYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSI 323
            ..::::.:.:|:|:|:..|..|.....:..:||.....|||..||....|......|.|:.|...
plant   381 FKHQMEIVGNIKHENVAPLRAYVCSKEEKLMVYDYDSNGSLSLRLHGKNADEGHVPLNWETRLRF 445

  Fly   324 SLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREG--PKSLDAVVEVNKVFG 386
            .:|.|:|:..:||..   |.||:||.:|:.::.      ..:|.:.|.  |...:.||..:....
plant   446 MIGVAKGLGHIHTQN---LAHGNIKSSNVFMNS------EGYGCISEAGLPLLTNPVVRADSSAR 501

  Fly   387 TKI-YLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNL------LDYVKQQW 444
            :.: |..||..:.|:.:...|:|||||::||..|||.:.|     :.|:.:      .|.:.:||
plant   502 SVLRYRAPEVTDTRRSTPESDIYSFGILMLETLTGRSIMD-----DRKEGIDLVVWVNDVISKQW 561

  Fly   445 RQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFEPFVTD 501
            ..   |:.:..|......|..: :..::.|..|||:.|..||.|..|::..|....|
plant   562 TG---EVFDLELVKTPNVEAKL-LQMLQLGTSCTAMVPAKRPDMVKVVETLEEIERD 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 14/62 (23%)
STKc_IRAK 219..498 CDD:270968 75/288 (26%)
TyrKc 219..495 CDD:197581 74/285 (26%)
AT5G24100NP_197798.1 LRRNT_2 30..68 CDD:369783
PLN00113 <70..613 CDD:215061 103/444 (23%)
leucine-rich repeat 99..122 CDD:275380
leucine-rich repeat 123..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..192 CDD:275380
PKc_like 347..611 CDD:389743 75/288 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.