DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G18610

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001190331.1 Gene:AT5G18610 / 831979 AraportID:AT5G18610 Length:513 Species:Arabidopsis thaliana


Alignment Length:337 Identity:104/337 - (30%)
Similarity:161/337 - (47%) Gaps:45/337 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KDYVSED-LHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLE 181
            ||..|:| :.|.:.....::::........:|...||            ..:...||.:|.|:  
plant    13 KDAASKDSVKKELSAKDGSVTQSHHISLDKSKSRRGP------------EQKKELTAPKEGPT-- 63

  Fly   182 SLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD--VAIKVMNY 244
                .||     ||::   ..:.||..||..:.|:..||:||||.||:|:.:...  ||:|    
plant    64 ----AHI-----AAQT---FTFRELAAATKNFRPECLLGEGGFGRVYKGRLETTGQIVAVK---- 112

  Fly   245 RSPNIDQKMVELQQSY-NELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKA 308
               .:|:..::..:.: .|:..|:.:.|.|::.|.||...|.:..|||:.|..||||..|  |..
plant   113 ---QLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHL--HDL 172

  Fly   309 QNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPK 373
            ......|.|..|.:|:.|.|:|:.:||.....|:|:.|:|.:||||.....||:.||||.:.||.
plant   173 PPDKEPLDWSTRMTIAAGAAKGLEYLHDKANPPVIYRDLKSSNILLGDGYHPKLSDFGLAKLGPV 237

  Fly   374 SLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD--RVPENETKKNL 436
            . |......:|.||..|..||:....||:...||||||:|.||:.|||:..|  |.|   .:.||
plant   238 G-DKTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVFLELITGRKAIDNARAP---GEHNL 298

  Fly   437 LDYVKQQWRQNR 448
            :.:.:..::..|
plant   299 VAWARPLFKDRR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 4/10 (40%)
STKc_IRAK 219..498 CDD:270968 83/235 (35%)
TyrKc 219..495 CDD:197581 83/235 (35%)
AT5G18610NP_001190331.1 STKc_IRAK 89..358 CDD:270968 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.