DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G02070

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_195827.1 Gene:AT5G02070 / 831776 AraportID:AT5G02070 Length:657 Species:Arabidopsis thaliana


Alignment Length:303 Identity:103/303 - (33%)
Similarity:154/303 - (50%) Gaps:24/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ELENATDGWSPDNRLGQGGFGDVYRGKWKQLDV-AIKVMNYRSPNIDQKMVELQQSYNELKYLNS 268
            |:..||:.:|.||.:|.||||:|::...:...: |||    |:...:.|..:  |..||::.|..
plant   355 EITKATNNFSKDNLIGTGGFGEVFKAVLEDGTITAIK----RAKLNNTKGTD--QILNEVRILCQ 413

  Fly   269 IRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYF 333
            :.|.:::.|.|..:....|.|:|:.:..|:|...|.....:...| |||::|..|:..||.|:.:
plant   414 VNHRSLVRLLGCCVDLELPLLIYEFIPNGTLFEHLHGSSDRTWKP-LTWRRRLQIAYQTAEGLAY 477

  Fly   334 LHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNK---VF----GTKIYL 391
            ||:|...|:.|.|:|.:|||||:.|..|:.||||.|    .:|.....|.   :|    ||..||
plant   478 LHSAAQPPIYHRDVKSSNILLDEKLNAKVSDFGLSR----LVDLTETANNESHIFTGAQGTLGYL 538

  Fly   392 PPE-FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKH 455
            .|| :||| ||:...||||||:||||:.|.::..|...|.| ..||:.|:.:...|.|:......
plant   539 DPEYYRNF-QLTDKSDVYSFGVVLLEMVTSKKAIDFTREEE-DVNLVMYINKMMDQERLTECIDP 601

  Fly   456 LAAPMGKELDMCMCAIEAGLHCTALDP--QDRPSMNAVLKRFE 496
            |......::||........|....|:.  |:||||..|....|
plant   602 LLKKTANKIDMQTIQQLGNLASACLNERRQNRPSMKEVADEIE 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 97/289 (34%)
TyrKc 219..495 CDD:197581 96/286 (34%)
AT5G02070NP_195827.1 GUB_WAK_bind 40..142 CDD:290658
TyrKc 364..643 CDD:197581 99/291 (34%)
STKc_IRAK 369..644 CDD:270968 96/287 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.