DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and LECRKA4.1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_195774.1 Gene:LECRKA4.1 / 831722 AraportID:AT5G01540 Length:682 Species:Arabidopsis thaliana


Alignment Length:305 Identity:95/305 - (31%)
Similarity:149/305 - (48%) Gaps:30/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EID------YAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQ 257
            |||      |.:|..||||:.....:|.||||.|::||....| :|:|.:      |......::
plant   348 EIDHPRRLRYRDLYVATDGFKKTGIIGTGGFGTVFKGKLPNSDPIAVKKI------IPSSRQGVR 406

  Fly   258 QSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFS 322
            :...|::.|..:||.|::.|.|:........|:|..:..|||::.|.....::. ..|:|..||.
plant   407 EFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRRSG-AVLSWNARFQ 470

  Fly   323 ISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR---EGPKSLDAVVEVNKV 384
            |:.|.|.|:.:||......:||.|:||:|:|:|..:.|::|||||.|   .|..|     |...:
plant   471 IAKGIASGLLYLHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLARLYERGTLS-----ETTAL 530

  Fly   385 FGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR- 448
            .||..|:.||.......|:..||::||::|||:..||:.||     .....|:|:|.:...... 
plant   531 VGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTD-----SGTFFLVDWVMELHANGEI 590

  Fly   449 MELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            :..::..|.:  |.:......|:..||.|....|..||||..||:
plant   591 LSAIDPRLGS--GYDGGEARLALAVGLLCCHQKPASRPSMRIVLR 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 86/280 (31%)
TyrKc 219..495 CDD:197581 86/280 (31%)
LECRKA4.1NP_195774.1 lectin_legume_LecRK_Arcelin_ConA 31..280 CDD:173887
STKc_IRAK 381..637 CDD:270968 81/272 (30%)
Pkinase 381..634 CDD:278497 81/272 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.