DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G16500

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197154.2 Gene:AT5G16500 / 831511 AraportID:AT5G16500 Length:636 Species:Arabidopsis thaliana


Alignment Length:375 Identity:105/375 - (28%)
Similarity:173/375 - (46%) Gaps:67/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SSAKVNNGPPFPSSSGVSNSNNNR------TSTTATEEIPSLESLGNIHISTVQRAAES---LLE 200
            :|.|..|.|...:.:...|..::.      .:|..|||               :..||.   :..
plant    12 TSQKSRNAPCTTNETNDDNVEHDEFRPPVVATTKRTEE---------------REPAEQQPPVKT 61

  Fly   201 IDYAELENATDGWSPDNRLGQGGFGDVYRGKWK---QLDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            .::.||..||..:..:..||:||||.||:|..:   || ||:|.::....:.:::.:.      |
plant    62 FNFRELATATKNFRQECLLGEGGFGRVYKGTLQSTGQL-VAVKQLDKHGLHGNKEFLA------E 119

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHK-AQNPLPALTWQQRFSISLG 326
            :..|..:.|.|::.|.||...|.:..||::.:.||||:..|...| .|.|   :.|..|..|:.|
plant   120 VLSLAKLEHPNLVKLIGYCADGDQRLLVFEYVSGGSLQDHLYEQKPGQKP---MDWITRMKIAFG 181

  Fly   327 TARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYL 391
            .|:|:.:||......:|:.|:|.:|||||....||:.||||....|.:.|::...::|..|..|.
plant   182 AAQGLDYLHDKVTPAVIYRDLKASNILLDAEFYPKLCDFGLHNLEPGTGDSLFLSSRVMDTYGYS 246

  Fly   392 PPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRM------E 450
            .||:.....|:...||||||:||||:.|||:..|....|: ::||:.:.:..::..:.      .
plant   247 APEYTRGDDLTVKSDVYSFGVVLLELITGRRAIDTTKPND-EQNLVAWAQPIFKDPKRYPDMADP 310

  Fly   451 LLEKHLAAPMGKELDMCMCAIEAGLH--------CTALDPQDRPSMNAVL 492
            ||.|:.:              |.||:        |...:|..||.::.|:
plant   311 LLRKNFS--------------ERGLNQAVAITSMCLQEEPTARPLISDVM 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 90/292 (31%)
TyrKc 219..495 CDD:197581 90/292 (31%)
AT5G16500NP_197154.2 S_TKc 74..346 CDD:214567 89/296 (30%)
STKc_IRAK 80..345 CDD:270968 89/289 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.