DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G15080

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197012.1 Gene:AT5G15080 / 831360 AraportID:AT5G15080 Length:493 Species:Arabidopsis thaliana


Alignment Length:399 Identity:119/399 - (29%)
Similarity:187/399 - (46%) Gaps:67/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VPTISELRAAPDS----------------SAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLE 181
            :|:.|:|.|:..|                :.|.|:.|....||..:.||...:|:|..       
plant    59 IPSKSDLDASSSSIYGSNCTVTTMESKSANEKSNDQPVGQVSSTTTTSNAESSSSTPV------- 116

  Fly   182 SLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ------------ 234
                  ||.....:..|.:..:.:|:.:|..:.|::.||:||||.|::| |.:            
plant   117 ------ISEELNISSHLRKFTFNDLKLSTRNFRPESLLGEGGFGCVFKG-WIEENGTAPVKPGTG 174

  Fly   235 LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSL 299
            |.||:|.:|   |:..|...|.   ..|:.:|.::.|.|::.|.||.|:..:..|||:.|..|||
plant   175 LTVAVKTLN---PDGLQGHKEW---LAEINFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSL 233

  Fly   300 EARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGD 364
            |..|  .:...|||   |..|..|:||.|:|:.|||.....|:|:.|.|.:|||||.....|:.|
plant   234 ENHL--FRRSLPLP---WSIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDADYNAKLSD 293

  Fly   365 FGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPE 429
            |||.::.|......|. .:|.||..|..||:.....|::..||||||:||||:.|||:..|:...
plant   294 FGLAKDAPDEGKTHVS-TRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRP 357

  Fly   430 NETKKNLLDYVKQQWRQNRM------ELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSM 488
            | .:.||:::.:......|.      ..||.|.:....:::      .:....|.:.||:.||.|
plant   358 N-GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKV------TQLAAQCLSRDPKIRPKM 415

  Fly   489 NAVLKRFEP 497
            :.|::..:|
plant   416 SDVVEALKP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 99/297 (33%)
TyrKc 219..495 CDD:197581 98/293 (33%)
AT5G15080NP_197012.1 STKc_IRAK 148..425 CDD:270968 99/297 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.