DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CDL1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_195900.2 Gene:CDL1 / 831285 AraportID:AT5G02800 Length:378 Species:Arabidopsis thaliana


Alignment Length:356 Identity:107/356 - (30%)
Similarity:172/356 - (48%) Gaps:42/356 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQ 221
            |...||.|..:|..::.:|.    :|.|:.||     .|::   ..::||..||..:..:..:|:
plant    29 SDCSVSTSEKSRAKSSLSES----KSKGSDHI-----VAQT---FTFSELATATRNFRKECLIGE 81

  Fly   222 GGFGDVYRGKWKQLD--VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKG 284
            ||||.||:|......  .|||.:::.....:::.:.      |:..|:.:.|.|::.|.||...|
plant    82 GGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLV------EVLMLSLLHHPNLVNLIGYCADG 140

  Fly   285 GKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKP 349
            .:..|||:.|..||||..|  |........|.|..|..|:.|.|:|:.:||.....|:|:.|:|.
plant   141 DQRLLVYEYMPLGSLEDHL--HDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKC 203

  Fly   350 ANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVL 414
            :|||||....||:.||||.:.||....:.|. .:|.||..|..||:....||:...||||||:||
plant   204 SNILLDDDYFPKLSDFGLAKLGPVGDKSHVS-TRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVL 267

  Fly   415 LEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR--MELLEKHLAA---PMGKELDMCMCAIEAG 474
            ||:.|||:..|. ..:..::||:.:.:..::..|  .::.:..|..   |.|....:.:.|:   
plant   268 LEIITGRKAIDS-SRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAM--- 328

  Fly   475 LHCTALDPQDRPSMNAVL--------KRFEP 497
              |....|..||.:..|:        ::|:|
plant   329 --CVQEQPNLRPLIADVVTALSYLASQKFDP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/294 (31%)
TyrKc 219..495 CDD:197581 90/290 (31%)
CDL1NP_195900.2 STKc_IRAK 79..347 CDD:270968 90/282 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.