DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PBS1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_196820.1 Gene:PBS1 / 831155 AraportID:AT5G13160 Length:456 Species:Arabidopsis thaliana


Alignment Length:335 Identity:113/335 - (33%)
Similarity:159/335 - (47%) Gaps:46/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VSEDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGN 185
            |.|..|....:|.||:|            ||....||.....:|..|..|  ..|.:...:.||.
plant    18 VDESNHGQKKQSQPTVS------------NNISGLPSGGEKLSSKTNGGS--KRELLLPRDGLGQ 68

  Fly   186 IHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-----VAIKVMNYR 245
            |...|          ..:.||..||..:.||..||:||||.||:|:   ||     ||:|     
plant    69 IAAHT----------FAFRELAAATMNFHPDTFLGEGGFGRVYKGR---LDSTGQVVAVK----- 115

  Fly   246 SPNIDQKMVELQQSY-NELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQ 309
              .:|:..::..:.: .|:..|:.:.|.|::.|.||...|.:..|||:.|..||||..|  |...
plant   116 --QLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHL--HDLP 176

  Fly   310 NPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKS 374
            ....||.|..|..|:.|.|:|:.|||.....|:|:.|.|.:|||||:...||:.||||.:.||..
plant   177 PDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTG 241

  Fly   375 LDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENETKKNLLD 438
            ..:.|. .:|.||..|..||:....||:...||||||:|.||:.|||:..| .:|..|  :||:.
plant   242 DKSHVS-TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGE--QNLVA 303

  Fly   439 YVKQQWRQNR 448
            :.:..:...|
plant   304 WARPLFNDRR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 3/6 (50%)
STKc_IRAK 219..498 CDD:270968 88/237 (37%)
TyrKc 219..495 CDD:197581 88/237 (37%)
PBS1NP_196820.1 STKc_IRAK 92..360 CDD:270968 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.