DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G11020

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_850806.2 Gene:AT5G11020 / 830969 AraportID:AT5G11020 Length:433 Species:Arabidopsis thaliana


Alignment Length:358 Identity:110/358 - (30%)
Similarity:167/358 - (46%) Gaps:62/358 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGG 223
            ||::..|....|.|..:.             |.::...||  |||..||..|.|:...|.|||||
plant   102 SGITFLNRFSRSKTLDKR-------------TTKQGTVSL--IDYNILEEGTSGFKESNILGQGG 151

  Fly   224 FGDVYRGKWK-QLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKP 287
            ||.||....: .:..|:|.::..:.:      ..::..:|::.|:.::|.||::|.|||......
plant   152 FGCVYSATLENNISAAVKKLDCANED------AAKEFKSEVEILSKLQHPNIISLLGYSTNDTAR 210

  Fly   288 CLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANI 352
            .:||:||...|||:.|......:   |:||..|..|:|...||:.:||......:||.|:|.:||
plant   211 FIVYELMPNVSLESHLHGSSQGS---AITWPMRMKIALDVTRGLEYLHEHCHPAIIHRDLKSSNI 272

  Fly   353 LLDQCLQPKIGDFGL-VREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLE 416
            |||.....||.|||| |.:|||:.:     :|:.||..|:.||:....||:...|||:||:||||
plant   273 LLDSNFNAKISDFGLAVVDGPKNKN-----HKLSGTVGYVAPEYLLNGQLTEKSDVYAFGVVLLE 332

  Fly   417 VFTGRQVTDRVPENE------------TKKNLLDYVKQQWRQNRMELLEKHL---AAPMGKELDM 466
            :..|::..:::...|            |.:..|..|.....::.|:|  |||   ||        
plant   333 LLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPSVIDPAIKDTMDL--KHLYQVAA-------- 387

  Fly   467 CMCAIEAGLHCTALDPQDRPSMNAVLKRFEPFV 499
                  ..:.|...:|..||.:..||....|.|
plant   388 ------VAILCVQPEPSYRPLITDVLHSLIPLV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/295 (31%)
TyrKc 219..495 CDD:197581 92/292 (32%)
AT5G11020NP_850806.2 STKc_IRAK 147..413 CDD:270968 92/295 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.