DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G10530

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_196615.1 Gene:AT5G10530 / 830918 AraportID:AT5G10530 Length:651 Species:Arabidopsis thaliana


Alignment Length:343 Identity:101/343 - (29%)
Similarity:161/343 - (46%) Gaps:63/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 EEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAI 239
            ||..:|.|:.    ..::|.| ...:..|.:|.:|.:.::.|.:||:||||.||||....||:.:
plant   302 EETENLTSIN----EDLERGA-GPRKFTYKDLASAANNFADDRKLGEGGFGAVYRGYLNSLDMMV 361

  Fly   240 KVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLR 304
            .:..:...:...|    ::...|:|.::|:||.|::.|.|:..:..:..::|:.|..|||:|.|.
plant   362 AIKKFAGGSKQGK----REFVTEVKIISSLRHRNLVQLIGWCHEKDEFLMIYEFMPNGSLDAHLF 422

  Fly   305 AHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR 369
            ..|     |.|.|..|..|:||.|..:.:||......::|.|||.:|::||.....|:|||||.|
plant   423 GKK-----PHLAWHVRCKITLGLASALLYLHEEWEQCVVHRDIKASNVMLDSNFNAKLGDFGLAR 482

  Fly   370 -----EGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPE 429
                 .||       :...:.||..|:.||:.:..:.|...||||||:|.||:.|||:..||   
plant   483 LMDHELGP-------QTTGLAGTFGYMAPEYISTGRASKESDVYSFGVVTLEIVTGRKSVDR--- 537

  Fly   430 NETKKNLLDYVKQQWRQNRME----LLEK--------HLAAPMGKEL-------DMCMCAIEAGL 475
                           ||.|:|    |:||        .:...:.::|       ....|.:..||
plant   538 ---------------RQGRVEPVTNLVEKMWDLYGKGEVITAIDEKLRIGGFDEKQAECLMIVGL 587

  Fly   476 HCTALDPQDRPSMNAVLK 493
            .|...|...|||:...::
plant   588 WCAHPDVNTRPSIKQAIQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/299 (30%)
TyrKc 219..495 CDD:197581 91/299 (30%)
AT5G10530NP_196615.1 Lectin_legB 19..263 CDD:278564
Pkinase 335..605 CDD:278497 92/303 (30%)
STKc_IRAK 341..608 CDD:270968 91/299 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.