DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RBK1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_568231.1 Gene:RBK1 / 830917 AraportID:AT5G10520 Length:467 Species:Arabidopsis thaliana


Alignment Length:430 Identity:107/430 - (24%)
Similarity:186/430 - (43%) Gaps:76/430 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KDYVSEDLHK--------YIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTAT 174
            |::...:||:        ..||.|  :..:..:.:||:..::......||..|:..:|.|.|.::
plant    12 KNHQEVELHRNDLGLEDSSSPRGV--LGMVSDSDNSSSSCSSCSSDDKSSSTSSPFSNTTKTVSS 74

  Fly   175 EE----------------------IPSLES--LGNIHISTVQ----------------RAAESLL 199
            ..                      ||.|.|  |...::...|                .|..|..
plant    75 SHHGLQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSWR 139

  Fly   200 EIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYNEL 263
            ...|.||..|||.::|:|.:|:||..:||:|.....: ||||.:...:...::::.:.   .:||
plant   140 NFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDF---LSEL 201

  Fly   264 KYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTA 328
            ..:..:.|.|...|.|:|...|.. .|.:....|||.:.|...:     ..|.|:.|:.::||.|
plant   202 GIIAHVNHPNAARLRGFSSDRGLH-FVLEYAPYGSLASMLFGSE-----ECLEWKIRYKVALGIA 260

  Fly   329 RGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSL--DAVVEVNKVFGTKIYL 391
            .|:.:||.|....:||.|||.:||||:...:.:|.||||.:..|::.  ..|..:...||   ||
plant   261 DGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFG---YL 322

  Fly   392 PPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHL 456
            .||:.....:...:||::||::|||:.|.|:..|    ..::::::.:.|....:|.||.:....
plant   323 APEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVD----TASRQSIVAWAKPFLEKNSMEDIVDPR 383

  Fly   457 AAPMGKELDMCMCAIEAGL---HCTALDPQDRPSMNAVLK 493
            ...|....:|....:.|.:   |..|:    ||.|..:::
plant   384 LGNMFNPTEMQRVMLTASMCVHHIAAM----RPDMTRLVQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 3/17 (18%)
STKc_IRAK 219..498 CDD:270968 77/281 (27%)
TyrKc 219..495 CDD:197581 77/281 (27%)
RBK1NP_568231.1 PKc_like 159..421 CDD:419665 77/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.