DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G35030

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001190918.1 Gene:AT4G35030 / 829655 AraportID:AT4G35030 Length:448 Species:Arabidopsis thaliana


Alignment Length:383 Identity:104/383 - (27%)
Similarity:172/383 - (44%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIH 187
            :.:||:..|.|..::.:.:.|                               |..|:.:...|..
plant    40 QQVHKWHTRKVSVVNWVMSLP-------------------------------ERFPNHQQTLNYE 73

  Fly   188 ISTVQRAAESLLE-----IDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRS 246
            .|.:::..:.:|.     .:|..|..||..:|.:|.:|:||..:||||..:. ..:|:|::...|
plant    74 TSLIKKQIKDILRDNNKWFNYNVLRKATSDFSQENVIGKGGCNEVYRGILEDGKGIAVKILKSSS 138

  Fly   247 PNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNP 311
            .......|      :|:..::|:.|.||..|.|..::..:...||.|...||||..|  |..|..
plant   139 KEAMTNFV------HEINIISSLSHQNISPLLGVCVQDNELISVYNLSNTGSLEETL--HGKQKG 195

  Fly   312 LPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLD 376
            ...|:|::||.|::|.|..:.:||.....|:||.|:|.:|:||...|||::.||||...||.:..
plant   196 KYVLSWEERFKIAIGLAEALDYLHNRCSKPVIHRDVKTSNVLLSLELQPQLSDFGLSMWGPTTSS 260

  Fly   377 AVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQ-VTDRVPENETK-----KN 435
            .......|.||..||.||:..:.::|..||||:||:||||:.:||. ::.:.|..:..     |.
plant   261 RYSIQGDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRNPISPQNPRGQESLVMWAKP 325

  Fly   436 LLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            |:|      ..|...||:..:.....:.....|  :.|..||.......||::..:|:
plant   326 LID------TGNLKVLLDPDVTDIFDESQFQRM--VLAASHCLTRSATHRPNIRQILR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 1/4 (25%)
STKc_IRAK 219..498 CDD:270968 88/282 (31%)
TyrKc 219..495 CDD:197581 88/282 (31%)
AT4G35030NP_001190918.1 PKc_like 110..377 CDD:419665 88/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.