DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G28350

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001320081.1 Gene:AT4G28350 / 828950 AraportID:AT4G28350 Length:681 Species:Arabidopsis thaliana


Alignment Length:401 Identity:111/401 - (27%)
Similarity:185/401 - (46%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 FPSSSG------------VSNSNNNRTSTTATEEIPSLESLGNIHIST----------------- 190
            |.:|:|            .||||.:......|..:||.:..|:..:.:                 
plant   241 FTASTGQLVQSHRILSWSFSNSNFSIGDALITRNLPSFKLSGDSVLKSKGFIAGVSSGVVLLVSV 305

  Fly   191 -------VQRAAESLLE--------------IDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ 234
                   |.|.....||              :.|.::..||.|:|.:|.:|.||...||||..:.
plant   306 IGLLCFYVVRRRRQRLEGDVEDWETEYWPHRVQYKDVLEATKGFSDENMIGYGGNSKVYRGVLEG 370

  Fly   235 LDVAIK-VMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKP-CLVYQLMKGG 297
            .:||:| :|  .||.  :.:....:...|:..|..:||.||:.|.|:|.|||:. .|:|:.|:.|
plant   371 KEVAVKRIM--MSPR--ESVGATSEFLAEVSSLGRLRHKNIVGLKGWSKKGGESLILIYEYMENG 431

  Fly   298 SLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKI 362
            |::.|:......     |.|::|..:....|.|:.:||....|.::|.|||.:|:|||:.:..::
plant   432 SVDKRIFDCNEM-----LNWEERMRVIRDLASGMLYLHEGWETKVLHRDIKSSNVLLDKDMNARV 491

  Fly   363 GDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRV 427
            |||||.:....|.: :|....|.||..|:.||.....:.|...||||||:.:|||..||:     
plant   492 GDFGLAKLQNTSKE-MVSTTHVVGTAGYMAPELVKTGRASAQTDVYSFGVFVLEVVCGRR----- 550

  Fly   428 PENETKKNLLDYVKQQW----RQNRMELLEKHLAAP---MGKELDMCMCAIEAGLHCTALDPQDR 485
            |..|.::.:::::   |    :...::.|::.:.|.   :.:|::|   |:..||.|...||:.|
plant   551 PIEEGREGIVEWI---WGLMEKDKVVDGLDERIKANGVFVVEEVEM---ALRIGLLCVHPDPRVR 609

  Fly   486 PSMNAVLKRFE 496
            |.|..|::..|
plant   610 PKMRQVVQILE 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 90/287 (31%)
TyrKc 219..495 CDD:197581 89/284 (31%)
AT4G28350NP_001320081.1 lectin_legume_LecRK_Arcelin_ConA 24..255 CDD:173887 3/13 (23%)
STKc_IRAK 355..621 CDD:270968 90/287 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.