DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G25390

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194269.1 Gene:AT4G25390 / 828642 AraportID:AT4G25390 Length:651 Species:Arabidopsis thaliana


Alignment Length:254 Identity:85/254 - (33%)
Similarity:121/254 - (47%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EIDYAELENATDGWSPDNRLGQGGFGDVYRGKWK-QLDVAIKVMNYRSPNIDQKMVELQ---QSY 260
            |..|:.|..||..:|..|||||||||.|:||... ..:||:|||:..|         ||   :..
plant    86 EFSYSSLRRATGSFSQANRLGQGGFGVVFRGTISGGENVAVKVMDSGS---------LQGEGEFQ 141

  Fly   261 NELKYLNSIRHDNILALYGYS--IKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSI 323
            |||.:...:...:::.:.|:|  .|..:..|||:||..|:|:..| .|:....|  :.|.:||.:
plant   142 NELFFAAKLDSPHVVPVIGFSHDRKRRRLLLVYKLMDNGNLQDAL-LHRRCPEL--MDWNRRFLV 203

  Fly   324 SLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLV--------------REGPKS 374
            ::..|.||..||:.. .|:|||||||:|:|||.....||.||||.              |:|..|
plant   204 AVNIADGIKHLHSLE-PPVIHGDIKPSNVLLDSLFSAKIADFGLARLKAEQVEISVAPERDGDGS 267

  Fly   375 LDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETK 433
            :  |.||..|..|              .||.:.::||:|           |:.||:..|
plant   268 M--VEEVESVVTT--------------VTGYEDFNFGLV-----------DQSPESVAK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 77/235 (33%)
TyrKc 219..495 CDD:197581 77/235 (33%)
AT4G25390NP_194269.1 PKc_like 105..>249 CDD:304357 60/156 (38%)
SPS1 <509..>621 CDD:223589
PKc_like <511..626 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.