DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK23

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194062.1 Gene:CRK23 / 828430 AraportID:AT4G23310 Length:830 Species:Arabidopsis thaliana


Alignment Length:338 Identity:103/338 - (30%)
Similarity:173/338 - (51%) Gaps:37/338 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NNNRTSTTATEEI----PSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFG 225
            |..|..|..||.:    .|:.:.|:             |:.|:..:..||:.:.|.|:|||||||
plant   469 NVKRKDTEVTEPLAENGDSITTAGS-------------LQFDFKAIVAATNNFLPINKLGQGGFG 520

  Fly   226 DVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCL 289
            :||:|.:.. :.||:|.::..|...:::.      .||:..:..::|.|::.|.||.::|.:..|
plant   521 EVYKGTFPSGVQVAVKRLSKTSGQGEREF------ENEVVVVAKLQHRNLVRLLGYCLEGEEKIL 579

  Fly   290 VYQLMKGGSLEARL--RAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANI 352
            ||:.:...||:..|  ...|.|     |.|.:|:.|..|.||||.:||......:||.|:|..||
plant   580 VYEFVHNKSLDYFLFDTTMKRQ-----LDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNI 639

  Fly   353 LLDQCLQPKIGDFGLVR-EGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLE 416
            |||..:.||:.|||:.| .|....:|  ...:|.||..|:.||:..:.|.|...||||||:::.|
plant   640 LLDADMNPKVADFGMARIFGMDQTEA--NTRRVVGTYGYMAPEYAMYGQFSMKSDVYSFGVLVFE 702

  Fly   417 VFTGRQVTDRVPENETKKNLLDYVKQQWRQ-NRMELLEKHLAAPMGKELDMCMCAIEAGLHCTAL 480
            :.:|.:.:.....:::..||:.|..:.|.. ::::|::....... :..|:..| |...|.|...
plant   703 IISGMKNSSLYQMDDSVSNLVTYTWRLWSNGSQLDLVDPSFGDNY-QTHDITRC-IHIALLCVQE 765

  Fly   481 DPQDRPSMNAVLK 493
            |..|||:|:|:::
plant   766 DVDDRPNMSAIVQ 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 90/280 (32%)
TyrKc 219..495 CDD:197581 90/280 (32%)
CRK23NP_194062.1 Stress-antifung 33..129 CDD:279926
Stress-antifung 145..240 CDD:279926
Stress-antifung 258..350 CDD:279926
TyrKc 511..780 CDD:197581 91/283 (32%)
STKc_IRAK 514..781 CDD:270968 90/280 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.