DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK22

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194061.2 Gene:CRK22 / 828429 AraportID:AT4G23300 Length:660 Species:Arabidopsis thaliana


Alignment Length:348 Identity:99/348 - (28%)
Similarity:168/348 - (48%) Gaps:60/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 FPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRL 219
            |.|.|.||.:|:                                |:.::..:|.||:.:|..|:|
plant   327 FESDSDVSTTNS--------------------------------LQYEFKTIEAATNKFSKSNKL 359

  Fly   220 GQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIK 283
            |:|.||:||:||:.. .:||:|.::..|....:|.      .||...::.|:|.|:..|.|:.::
plant   360 GEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKF------RNEAVLVSKIQHRNLARLLGFCLQ 418

  Fly   284 GGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIK 348
            |....|:|:.:...||:..|...:.|.   .|.|.:|:.|..|.|:||..||......:|:.|.|
plant   419 GDGKFLIYEFVLNKSLDYFLFDPEKQG---ELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFK 480

  Fly   349 PANILLDQCLQPKIGDFGL-----VREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVY 408
            .:|||||..:.|||.|||:     :.|...:.:.:.|      |.:|:.||:....:.|...|||
plant   481 ASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAE------TFVYMSPEYAVHGKFSMKSDVY 539

  Fly   409 SFGIVLLEVFTGRQVTDRVPENETKK--NLLDYVKQQWRQ-NRMELLEKHLAAP-MGKELDMCMC 469
            ||||::||:.:|::.:.....:||..  ||:.|..:.||. ::::||:..:... ...|:..|  
plant   540 SFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRC-- 602

  Fly   470 AIEAGLHCTALDPQDRPSMNAVL 492
             |...|.|...:|:|||.::.::
plant   603 -IHIALLCVQENPEDRPKLSTIV 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 87/284 (31%)
TyrKc 219..495 CDD:197581 87/284 (31%)
CRK22NP_194061.2 Stress-antifung 26..124 CDD:396296
Stress-antifung <175..245 CDD:396296
STKc_IRAK 359..628 CDD:270968 87/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.