DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK10

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_567679.2 Gene:CRK10 / 828417 AraportID:AT4G23180 Length:669 Species:Arabidopsis thaliana


Alignment Length:299 Identity:99/299 - (33%)
Similarity:163/299 - (54%) Gaps:21/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            |::||..::.|||.:...|::||||||:||:|.... .:||:|.:   |.:..|..||.:   ||
plant   334 LQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRL---SKSSGQGEVEFK---NE 392

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARL--RAHKAQNPLPALTWQQRFSISL 325
            :..:..::|.|::.|.|:.:.|.:..|||:.:...||:..|  .|.|.|     |.|.:|:.|..
plant   393 VVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQ-----LDWTRRYKIIG 452

  Fly   326 GTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVE-VNKVFGTKI 389
            |.||||.:||......:||.|:|.:|||||..:.|||.|||:.|  ...||...| .:::.||..
plant   453 GVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMAR--IFGLDQTEENTSRIVGTYG 515

  Fly   390 YLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR-MELLE 453
            |:.||:....|.|...||||||:::||:.:|:: .....:.:...:|:.|....|...| :||::
plant   516 YMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKK-NSSFYQTDGAHDLVSYAWGLWSNGRPLELVD 579

  Fly   454 KHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            ..:.....:. ::..| :..||.|...||.:||:::.::
plant   580 PAIVENCQRN-EVVRC-VHIGLLCVQEDPAERPTLSTIV 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/279 (33%)
TyrKc 219..495 CDD:197581 92/279 (33%)
CRK10NP_567679.2 Stress-antifung 43..138 CDD:279926
TyrKc 353..619 CDD:197581 92/280 (33%)
STKc_IRAK 354..620 CDD:270968 92/279 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.