DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G02420

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_567234.1 Gene:AT4G02420 / 828035 AraportID:AT4G02420 Length:669 Species:Arabidopsis thaliana


Alignment Length:296 Identity:94/296 - (31%)
Similarity:159/296 - (53%) Gaps:21/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRG---KWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELK 264
            :.:|..||.|:...|.||.||||.||:|   |.|: ::|:|.::      ::....|::...|:.
plant   340 FKDLYYATKGFKDKNILGSGGFGSVYKGIMPKTKK-EIAVKRVS------NESRQGLKEFVAEIV 397

  Fly   265 YLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTAR 329
            .:..:.|.|::.|.||..:..:..|||..|..|||:..|    ..:|...|.|:|||.:..|.|.
plant   398 SIGQMSHRNLVPLVGYCRRRDELLLVYDYMPNGSLDKYL----YNSPEVTLDWKQRFKVINGVAS 458

  Fly   330 GIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPE 394
            .:::||......:||.|:|.:|:|||..|..::|||||.:......|.  :..:|.||..||.|:
plant   459 ALFYLHEEWEQVVIHRDVKASNVLLDAELNGRLGDFGLAQLCDHGSDP--QTTRVVGTWGYLAPD 521

  Fly   395 FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQ-NRMELLEKHLAA 458
            .....:.:|..||::||::||||..||:..:...::..:..|:|:|.:.|.: |.::..:.:|.:
plant   522 HIRTGRATTTTDVFAFGVLLLEVACGRRPIEINNQSGERVVLVDWVFRFWMEANILDAKDPNLGS 586

  Fly   459 PMG-KELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            ... ||::|   .::.||.|:..||..||:|..||:
plant   587 EYDQKEVEM---VLKLGLLCSHSDPLARPTMRQVLQ 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/280 (32%)
TyrKc 219..495 CDD:197581 89/280 (32%)
AT4G02420NP_567234.1 Lectin_legB 26..275 CDD:278564
STYKc 355..621 CDD:214568 89/281 (32%)
STKc_IRAK 356..621 CDD:270968 89/280 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.