DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and SRF3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001329389.1 Gene:SRF3 / 827941 AraportID:AT4G03390 Length:776 Species:Arabidopsis thaliana


Alignment Length:334 Identity:91/334 - (27%)
Similarity:143/334 - (42%) Gaps:82/334 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 SLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPN--------IDQKM 253
            |:.....|.|:..|:.::.:|.:|.|..|.|||.              |.||        :|::.
plant   469 SVKHYSIASLQQYTESFAQENLIGSGMLGSVYRA--------------RLPNGKLFAVKKLDKRA 519

  Fly   254 VELQQSYNELKYLNS---IRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPAL 315
            .|.||.:..::.:|:   |||.||:.|.||..:..:..|||:....|:|:..|  |........|
plant   520 SEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGL--HSDDEFKKKL 582

  Fly   316 TWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVE 380
            :|..|.|::||.||.:.:||.....|:||.:.|.||:|||..|...:.|.||.     .|.:...
plant   583 SWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLA-----PLISSGS 642

  Fly   381 VNKVFGTKI----YLPPEFRNFRQLSTGV-----DVYSFGIVLLEVFTGRQVTDRVPENETKKNL 436
            |:::.|..:    |..|||      .:|:     ||||||:|:||:.|||...||          
plant   643 VSQLSGQLLAAYGYGAPEF------DSGIYTWQSDVYSFGVVMLELLTGRMSYDR---------- 691

  Fly   437 LDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLH-----------------CTALDPQD 484
                    .::|.|......|.|...::|.....::..|:                 |...:|:.
plant   692 --------DRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEF 748

  Fly   485 RPSMNAVLK 493
            ||.|:.|::
plant   749 RPLMSEVVQ 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 86/312 (28%)
TyrKc 219..495 CDD:197581 86/312 (28%)
SRF3NP_001329389.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.