DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK41

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_567204.3 Gene:CRK41 / 827936 AraportID:AT4G00970 Length:665 Species:Arabidopsis thaliana


Alignment Length:334 Identity:103/334 - (30%)
Similarity:174/334 - (52%) Gaps:32/334 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGK 231
            ||.:.....|...||.|   .|...|     ||::|:..:..||:.:|.||:||:||||.||:| 
plant   306 NRRTAKQRHEGKDLEEL---MIKDAQ-----LLQLDFDTIRLATNDFSRDNQLGEGGFGAVYKG- 361

  Fly   232 WKQLD----VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQ 292
              .||    :|:|.::.:|...|.:.:      ||:..:..::|.|::.|.|:.::|.:..|:|:
plant   362 --VLDYGEEIAVKRLSMKSGQGDNEFI------NEVSLVAKLQHRNLVRLLGFCLQGEERILIYE 418

  Fly   293 LMKGGSLEARLRAHKA--QNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLD 355
            ..|..||:     |..  .|....|.|:.|:.|..|.|||:.:||......::|.|:|.:|:|||
plant   419 FFKNTSLD-----HYIFDSNRRMILDWETRYRIISGVARGLLYLHEDSRFKIVHRDMKASNVLLD 478

  Fly   356 QCLQPKIGDFGLVREGPKSLDAVVE-VNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFT 419
            ..:.|||.|||:.:.......:... .:||.||..|:.||:....:.|...||:|||:::||:..
plant   479 DAMNPKIADFGMAKLFDTDQTSQTRFTSKVAGTYGYMAPEYAMSGEFSVKTDVFSFGVLVLEIIK 543

  Fly   420 GRQVTDRVPENETKKNLLDYVKQQWRQNR-MELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQ 483
            |:: .:..||.::...||.||.:.||:.. :.:::..|...:|...::..| |..||.|...:.:
plant   544 GKK-NNWSPEEDSSLFLLSYVWKSWREGEVLNIVDPSLVETIGVSDEIMKC-IHIGLLCVQENAE 606

  Fly   484 DRPSMNAVL 492
            .||:|.:|:
plant   607 SRPTMASVV 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 87/282 (31%)
TyrKc 219..495 CDD:197581 87/282 (31%)
CRK41NP_567204.3 Stress-antifung 49..144 CDD:279926
Stress-antifung <180..256 CDD:279926
TyrKc 347..618 CDD:197581 89/285 (31%)
STKc_IRAK 350..619 CDD:270968 87/282 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.