DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK28

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001320019.1 Gene:CRK28 / 827892 AraportID:AT4G21400 Length:683 Species:Arabidopsis thaliana


Alignment Length:297 Identity:100/297 - (33%)
Similarity:164/297 - (55%) Gaps:16/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWK-QLDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            |.:|:..|:.|||.:||:|.||:||||.||:|.:. ..::|:|.::..|...|.:.      .||
plant   347 LVVDFETLKAATDNFSPENELGRGGFGSVYKGVFSGGQEIAVKRLSCTSGQGDSEF------KNE 405

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGT 327
            :..|..::|.|::.|.|:.|:|.:..|||:.:|..||:..:...|.:.   .|.|..|:.:..|.
plant   406 ILLLAKLQHRNLVRLLGFCIEGQERILVYEFIKNASLDNFIFDLKKRQ---LLDWGVRYKMIGGV 467

  Fly   328 ARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVE-VNKVFGTKIYL 391
            |||:.:||......:||.|:|.:||||||.:.|||.||||.:.......:... .:|:.||..|:
plant   468 ARGLLYLHEDSRYRIIHRDLKASNILLDQEMNPKIADFGLAKLYDTDQTSTHRFTSKIAGTYGYM 532

  Fly   392 PPEFRNFRQLSTGVDVYSFGIVLLEVFTGR-QVTDRVPENETKKNLLDYVKQQWRQN-RMELLEK 454
            .||:..:.|.|...||:|||::::|:.||: ....|..::|..:|||.:|.:.||:: .:.:::.
plant   533 APEYAIYGQFSVKTDVFSFGVLVIEIITGKGNNNGRSNDDEEAENLLSWVWRCWREDIILSVIDP 597

  Fly   455 HLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAV 491
            .|......|:..|   |..||.|....|..||:|::|
plant   598 SLTTGSRSEILRC---IHIGLLCVQESPASRPTMDSV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/277 (33%)
TyrKc 219..495 CDD:197581 91/277 (33%)
CRK28NP_001320019.1 Stress-antifung 40..132 CDD:279926
Stress-antifung <168..247 CDD:279926
Pkinase 361..631 CDD:278497 93/281 (33%)
STKc_IRAK 367..636 CDD:270968 91/277 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.