DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G02010

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_192110.2 Gene:AT4G02010 / 827234 AraportID:AT4G02010 Length:725 Species:Arabidopsis thaliana


Alignment Length:298 Identity:104/298 - (34%)
Similarity:155/298 - (52%) Gaps:17/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 IDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELK 264
            :.|.||:.||..:...:.||:||||.||||.... ..||||.:....|..|:   |.|.   |:.
plant   368 LSYEELKEATSNFESASILGEGGFGKVYRGILADGTAVAIKKLTSGGPQGDK---EFQV---EID 426

  Fly   265 YLNSIRHDNILALYGY--SIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGT 327
            .|:.:.|.|::.|.||  |....:..|.|:|:..|||||.|......| .| |.|..|..|:|..
plant   427 MLSRLHHRNLVKLVGYYSSRDSSQHLLCYELVPNGSLEAWLHGPLGLN-CP-LDWDTRMKIALDA 489

  Fly   328 ARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLP 392
            |||:.:||......:||.|.|.:||||:.....|:.||||.::.|:.....:. .:|.||..|:.
plant   490 ARGLAYLHEDSQPSVIHRDFKASNILLENNFNAKVADFGLAKQAPEGRGNHLS-TRVMGTFGYVA 553

  Fly   393 PEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWR-QNRM-ELLEKH 455
            ||:.....|....||||:|:||||:.|||:..| :.:...::||:.:.:...| ::|: ||::..
plant   554 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVD-MSQPSGQENLVTWTRPVLRDKDRLEELVDSR 617

  Fly   456 LAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            |.....||..:.:|.|.|.  |.|.:...||:|..|::
plant   618 LEGKYPKEDFIRVCTIAAA--CVAPEASQRPTMGEVVQ 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 99/280 (35%)
TyrKc 219..495 CDD:197581 99/280 (35%)
AT4G02010NP_192110.2 TyrKc 384..655 CDD:197581 99/282 (35%)
STKc_IRAK 386..656 CDD:270968 99/280 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.