DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT4G02010

DIOPT Version :10

Sequence 1:NP_476971.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_192110.2 Gene:AT4G02010 / 827234 AraportID:AT4G02010 Length:725 Species:Arabidopsis thaliana


Alignment Length:146 Identity:32/146 - (21%)
Similarity:50/146 - (34%) Gaps:46/146 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPFAVDKCPKE-----------------------------YDEYKFTLPALYREVAKEELREDDL 41
            |...||||.::                             |:...|.|..:..|:|.|::..|.:
plant   503 LKLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLI 567

  Fly    42 VLVKALTEMRHWIAEN-PYIFKCRTDAKFLLRFLRF--RQFSVPMAC----EALER------YLT 93
            .||.|:.||.....:| |...:|...| ....:|..  ...:||..|    |.:|.      ||.
plant   568 RLVLAVQEMALNNEDNLPAYCRCAIQA-LCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLL 631

  Fly    94 VRELY---PGWFKKLD 106
            ..:::   |.|...:|
plant   632 PEDIFTEKPQWSSSMD 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_476971.1 Death_Pelle 32..128 CDD:260021 23/91 (25%)
STKc_IRAK 219..498 CDD:270968
AT4G02010NP_192110.2 STKc_IRAK 386..656 CDD:270968 32/146 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.