DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK32

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_192887.1 Gene:CRK32 / 826753 AraportID:AT4G11480 Length:656 Species:Arabidopsis thaliana


Alignment Length:303 Identity:101/303 - (33%)
Similarity:167/303 - (55%) Gaps:18/303 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW-KQLDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            |:.|:..||.|||.:|.:|:||:||||:||:|.. .:.:||:|.:   |.|..|...|.:   ||
plant   307 LQFDFMTLEAATDKFSRNNKLGKGGFGEVYKGMLPNETEVAVKRL---SSNSGQGTQEFK---NE 365

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPL-----PALTWQQRFS 322
            :..:..::|.|::.|.|:.::..:..|||:.:...||...|..:|.::.|     ..|.|::|::
plant   366 VVIVAKLQHKNLVRLLGFCLERDEQILVYEFVPNKSLNYFLFGNKQKHLLDPTKKSQLDWKRRYN 430

  Fly   323 ISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVE-VNKVFG 386
            |..|..||:.:||......:||.|||.:|||||..:.|||.|||:.|.  ..:|...: ..:|.|
plant   431 IIGGITRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMARN--FRVDQTEDNTRRVVG 493

  Fly   387 TKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR-ME 450
            |..|:|||:....|.||..||||||:::||:..|::.:.....:::..||:.:|.:.|..:. ::
plant   494 TFGYMPPEYVTHGQFSTKSDVYSFGVLILEIVCGKKNSSFYKIDDSGGNLVTHVWRLWNNDSPLD 558

  Fly   451 LLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            |::.  |.....:.|..:..|..||.|....|.|||.|:.:.:
plant   559 LIDP--AIEESCDNDKVIRCIHIGLLCVQETPVDRPEMSTIFQ 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/283 (33%)
TyrKc 219..495 CDD:197581 92/283 (33%)
CRK32NP_192887.1 Stress-antifung 25..122 CDD:279926
Stress-antifung <182..234 CDD:279926
STYKc 324..601 CDD:214568 93/286 (33%)
STKc_IRAK 327..603 CDD:270968 92/283 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.