DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK31

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001329009.1 Gene:CRK31 / 826752 AraportID:AT4G11470 Length:671 Species:Arabidopsis thaliana


Alignment Length:301 Identity:101/301 - (33%)
Similarity:167/301 - (55%) Gaps:22/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW-KQLDVAIKVMNYRSPNIDQKMVELQQSYNE 262
            |:.|:..:|.|||.:|.:|:|||||||:||:|.. .:.::|:|.:   |.|..|...|.:   ||
plant   330 LQFDFTTIEVATDNFSRNNKLGQGGFGEVYKGMLPNETEIAVKRL---SSNSGQGTQEFK---NE 388

  Fly   263 LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGT 327
            :..:..::|.|::.|.|:.|:..:..|||:.:...||:..|...|.::   .|.|::|::|..|.
plant   389 VVIVAKLQHKNLVRLLGFCIERDEQILVYEFVSNKSLDYFLFDPKMKS---QLDWKRRYNIIGGV 450

  Fly   328 ARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVV-EVNKVFGTKIYL 391
            .||:.:||......:||.|||.:|||||..:.|||.|||:.|.  ..:|... :..:|.||..|:
plant   451 TRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMARN--FRVDQTEDQTGRVVGTFGYM 513

  Fly   392 PPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR-MELLEKH 455
            |||:....|.||..||||||:::||:..|::.:.....:::..||:.:|.:.|..:. ::|::  
plant   514 PPEYVTHGQFSTKSDVYSFGVLILEIVCGKKNSSFFQMDDSGGNLVTHVWRLWNNDSPLDLID-- 576

  Fly   456 LAAPMGKEL---DMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
               |..||.   |..:..|..|:.|....|.|||.|:.:.:
plant   577 ---PAIKESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQ 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/281 (33%)
TyrKc 219..495 CDD:197581 93/281 (33%)
CRK31NP_001329009.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.