DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK37

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_192359.1 Gene:CRK37 / 825780 AraportID:AT4G04500 Length:646 Species:Arabidopsis thaliana


Alignment Length:410 Identity:121/410 - (29%)
Similarity:195/410 - (47%) Gaps:57/410 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YVSEDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRT---STTATEEIPSLE 181
            |...||:.|.           .|.|:..:|...||..||:.:....:.::   |..|...:||:.
plant   244 YFRWDLYPYY-----------RAFDNVVRVPAPPPQASSTIIDYGRDEKSFQGSNIAIIVVPSVI 297

  Fly   182 SL--------------GNIHISTV--QRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRG 230
            :|              .:..|:.|  ....:|:|..|...:..||:.:|.:|:|||||||.||:|
plant   298 NLIIFVVLIFSWKRKQSHTIINDVFDSNNGQSMLRFDLRMIVTATNNFSLENKLGQGGFGSVYKG 362

  Fly   231 KWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLM 294
            .... .::|:|.:...|   .|..:|.:   ||:..|..::|.|::.|.|:..:..:..|||:.:
plant   363 ILPSGQEIAVKRLRKGS---GQGGMEFK---NEVLLLTRLQHRNLVKLLGFCNEKDEEILVYEFV 421

  Fly   295 KGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQ 359
            ...||:..:...:.:.   .|||..|::|..|.|||:.:||......:||.|:|.:|||||..:.
plant   422 PNSSLDHFIFDEEKRR---VLTWDVRYTIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMN 483

  Fly   360 PKIGDFGLVR-------EGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEV 417
            ||:.|||:.|       .|        :.::|.||..|:.||:..:.|.||..||||||::|||:
plant   484 PKVADFGMARLFDMDETRG--------QTSRVVGTYGYMAPEYATYGQFSTKSDVYSFGVMLLEM 540

  Fly   418 FTGRQVTD-RVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGK-ELDMCMCAIEAGLHCTAL 480
            .:|:.... ...|.|.::.|..:|.::|.:.|...:...||||... .::..|..|..||.|...
plant   541 ISGKSNKKLEKEEEEEEEELPAFVWKRWIEGRFAEIIDPLAAPSNNISINEVMKLIHIGLLCVQE 605

  Fly   481 DPQDRPSMNAVLKRFEPFVT 500
            |...|||:|::|...|...|
plant   606 DISKRPSINSILFWLERHAT 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 3/7 (43%)
STKc_IRAK 219..498 CDD:270968 95/288 (33%)
TyrKc 219..495 CDD:197581 94/285 (33%)
CRK37NP_192359.1 Stress-antifung 29..127 CDD:279926
Stress-antifung 168..248 CDD:279926 1/3 (33%)
Pkinase 345..617 CDD:278497 95/288 (33%)
STKc_IRAK 351..622 CDD:270968 94/287 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.