DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK36

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_192358.1 Gene:CRK36 / 825779 AraportID:AT4G04490 Length:658 Species:Arabidopsis thaliana


Alignment Length:308 Identity:95/308 - (30%)
Similarity:159/308 - (51%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQS 259
            ::.|..|...:..||:.:|.:|:|||||||.||:|.... .::|:|.:   :....|..:|.:  
plant   323 QATLRFDLGMILIATNEFSLENKLGQGGFGSVYKGILPSGQEIAVKRL---AGGSGQGELEFK-- 382

  Fly   260 YNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKA--QNPLPALTWQQRFS 322
             ||:..|..::|.|::.|.|:..:|.:..|||:.:...||:     |..  ::....|||..|:.
plant   383 -NEVLLLTRLQHRNLVKLLGFCNEGNEEILVYEHVPNSSLD-----HFIFDEDKRWLLTWDVRYR 441

  Fly   323 ISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR-------EGPKSLDAVVE 380
            |..|.|||:.:||......:||.|:|.:|||||..:.||:.|||:.|       .|        |
plant   442 IIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKVADFGMARLFNMDETRG--------E 498

  Fly   381 VNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWR 445
            .::|.||..|:.||:....|.|...||||||::|||:.:|.:     .:|...:.|..:..::|.
plant   499 TSRVVGTYGYMAPEYVRHGQFSAKSDVYSFGVMLLEMISGEK-----NKNFETEGLPAFAWKRWI 558

  Fly   446 QNRME-LLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            :..:| :::.:|......|:   :..|:.||.|...:...||:||:|:
plant   559 EGELESIIDPYLNENPRNEI---IKLIQIGLLCVQENAAKRPTMNSVI 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/285 (31%)
TyrKc 219..495 CDD:197581 89/285 (31%)
CRK36NP_192358.1 Stress-antifung 29..124 CDD:279926
Stress-antifung 162..242 CDD:279926
STYKc 341..606 CDD:214568 91/290 (31%)
STKc_IRAK 346..606 CDD:270968 89/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.