DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and MEE39

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_190217.2 Gene:MEE39 / 823778 AraportID:AT3G46330 Length:878 Species:Arabidopsis thaliana


Alignment Length:299 Identity:92/299 - (30%)
Similarity:141/299 - (47%) Gaps:32/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYNELK-- 264
            |:|:...|.  :....||:||||.||.|.....: ||:|:::..|          .|.|.|.|  
plant   558 YSEVMEMTK--NLQRPLGEGGFGVVYHGDLNGSEQVAVKLLSQTS----------AQGYKEFKAE 610

  Fly   265 --YLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGT 327
              .|..:.|.|::.|.||..:.....|:|:.|..|.|...|......:   .|.|..|..|::..
plant   611 VELLLRVHHINLVNLVGYCDEQDHFALIYEYMSNGDLHQHLSGKHGGS---VLNWGTRLQIAIEA 672

  Fly   328 ARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVRE----GPKSLDAVVEVNKVFGTK 388
            |.|:.:|||.....::|.|:|..|||||:..:.||.||||.|.    |.:|..:.|    |.||.
plant   673 ALGLEYLHTGCKPAMVHRDVKSTNILLDEEFKAKIADFGLSRSFQVGGDQSQVSTV----VAGTL 733

  Fly   389 IYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLE 453
            .||.||:....:||...|||||||:|||:.|.::|.|:..||......:.:|.:  :.:..::::
plant   734 GYLDPEYYLTSELSEKSDVYSFGILLLEIITNQRVIDQTRENPNIAEWVTFVIK--KGDTSQIVD 796

  Fly   454 KHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            ..|..  ..:......|:|..:.|.......||:|:.|:
plant   797 PKLHG--NYDTHSVWRALEVAMSCANPSSVKRPNMSQVI 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/283 (31%)
TyrKc 219..495 CDD:197581 89/283 (31%)
MEE39NP_190217.2 Malectin_like 34..356 CDD:372329
PLN00113 <434..>480 CDD:215061
leucine-rich repeat 438..461 CDD:275380
leucine-rich repeat 462..492 CDD:275380
STKc_IRAK 572..833 CDD:270968 88/281 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.