DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and HERK1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_190214.1 Gene:HERK1 / 823774 AraportID:AT3G46290 Length:830 Species:Arabidopsis thaliana


Alignment Length:420 Identity:125/420 - (29%)
Similarity:189/420 - (45%) Gaps:74/420 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHIS 189
            :|...|.::....|:....:|..:::.|...|.||..|.||......:|...:.::..||:..:.
plant   363 VHTDYPNAIVNGLEIMKMNNSKGQLSTGTFVPGSSSSSKSNLGLIVGSAIGSLLAVVFLGSCFVL 427

  Fly   190 TVQR----------------------------------AAESLLEIDYAELENATDGWSPDNRLG 220
            ..:|                                  ...:...|.:|.:::||:.:.....:|
plant   428 YKKRKRGQDGHSKTWMPFSINGTSMGSKYSNGTTLTSITTNANYRIPFAAVKDATNNFDESRNIG 492

  Fly   221 QGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKG 284
            .||||.||:|:... ..||:|..|   |...|.:.|.:   .|::.|:..||.::::|.||..:.
plant   493 VGGFGKVYKGELNDGTKVAVKRGN---PKSQQGLAEFR---TEIEMLSQFRHRHLVSLIGYCDEN 551

  Fly   285 GKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKP 349
            .:..|:|:.|:.|:    :::|...:.||:|||:||..|.:|.|||:::|||....|:||.|:|.
plant   552 NEMILIYEYMENGT----VKSHLYGSGLPSLTWKQRLEICIGAARGLHYLHTGDSKPVIHRDVKS 612

  Fly   350 ANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVL 414
            ||||||:....|:.||||.:.||: ||.......|.|:..||.||:...:||:...||||||:||
plant   613 ANILLDENFMAKVADFGLSKTGPE-LDQTHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVL 676

  Fly   415 LEVFTGRQVTDRVPENE-----------TKKNLLD-YVKQQWRQN-RMELLEKHLAAPMGKELDM 466
            .||...|.|.|.....|           .||..|| .:.|..|.| |.:.|.|.           
plant   677 FEVLCARPVIDPTLPREMVNLAEWAMKWQKKGQLDQIIDQSLRGNIRPDSLRKF----------- 730

  Fly   467 CMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
                .|.|..|.|....|||||..||...|
plant   731 ----AETGEKCLADYGVDRPSMGDVLWNLE 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 1/2 (50%)
STKc_IRAK 219..498 CDD:270968 106/292 (36%)
TyrKc 219..495 CDD:197581 105/289 (36%)
HERK1NP_190214.1 Malectin_like 33..380 CDD:372329 3/16 (19%)
STKc_IRAK 491..756 CDD:270968 105/290 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.