DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK4

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_190172.1 Gene:CRK4 / 823729 AraportID:AT3G45860 Length:676 Species:Arabidopsis thaliana


Alignment Length:403 Identity:110/403 - (27%)
Similarity:188/403 - (46%) Gaps:81/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNN------------------------NRTS 170
            |||.|. .:|:.||         ||..|..|...:::                        .:|.
plant   262 PRSTPQ-QQLKLAP---------PPLISERGKGRNSSVIIVVVVPIIALLLLFVAFFSLRAKKTR 316

  Fly   171 TT-----ATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRG 230
            |.     .|||...:.:.|:             |:.|:..:|.||:.:...|:|||||||:||:|
plant   317 TNYEREPLTEESDDITTAGS-------------LQFDFKAIEAATNKFCETNKLGQGGFGEVYKG 368

  Fly   231 KWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLM 294
            .:.. :.||:|.::..|...:::..      ||:..:..::|.|::.|.|:.::..:..|||:.:
plant   369 IFPSGVQVAVKRLSKTSGQGEREFA------NEVIVVAKLQHRNLVRLLGFCLERDERILVYEFV 427

  Fly   295 KGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQ 359
            ...||:..:.....|:   .|.|.:|:.|..|.||||.:||......:||.|:|..||||...:.
plant   428 PNKSLDYFIFDSTMQS---LLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLGDDMN 489

  Fly   360 PKIGDFGLVR-EGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQV 423
            .||.|||:.| .|....:|  ...::.||..|:.||:..:.|.|...||||||:::||:.:|::.
plant   490 AKIADFGMARIFGMDQTEA--NTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKKN 552

  Fly   424 TDRVPENETKK-NLLDYVKQQWRQ-NRMELLEKHLAAPMGK------ELDMCMCAIEAGLHCTAL 480
            ::....:.|.. ||:.|..:.|.. :.:||::     |..:      |:..|   |...|.|...
plant   553 SNVYQMDGTSAGNLVTYTWRLWSNGSPLELVD-----PSFRDNYRINEVSRC---IHIALLCVQE 609

  Fly   481 DPQDRPSMNAVLK 493
            :.:|||:|:|:::
plant   610 EAEDRPTMSAIVQ 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 87/285 (31%)
TyrKc 219..495 CDD:197581 87/285 (31%)
CRK4NP_190172.1 Stress-antifung 36..131 CDD:366744
Stress-antifung 154..242 CDD:366744
STKc_IRAK 357..625 CDD:270968 87/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.