DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G28690

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001030790.3 Gene:AT3G28690 / 822499 AraportID:AT3G28690 Length:476 Species:Arabidopsis thaliana


Alignment Length:375 Identity:115/375 - (30%)
Similarity:184/375 - (49%) Gaps:54/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SSSGVSNSNNNRTSTTA---------------TEEIPSLESLGNIHISTVQRAAESLLEI-DYAE 205
            ||....:|:.|.|:..|               |::....||..:..:.:.:....|.|.| .:.:
plant    54 SSRSKVDSSMNATAVIAEPKKVIEKLEGHPAPTKDTGCAESGSSTPLMSGELKYSSKLRIFMFND 118

  Fly   206 LENATDGWSPDNRLGQGGFGDVYRGKWKQ------------LDVAIKVMNYRSPNIDQKMVELQQ 258
            |:.||..:.|::.||:||||.|::| |.:            |.||:|.:|   |:..|...|.  
plant   119 LKLATRNFRPESLLGEGGFGCVFKG-WIEENGTAPVKPGTGLTVAVKTLN---PDGLQGHKEW-- 177

  Fly   259 SYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSI 323
             ..|:.:|.::.|.:::.|.||.::..:..|||:.|..||||    .|..:..|| |.|..|..|
plant   178 -LAEINFLGNLVHPSLVKLVGYCMEEDQRLLVYEFMPRGSLE----NHLFRRTLP-LPWSVRMKI 236

  Fly   324 SLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTK 388
            :||.|:|:.|||.....|:|:.|.|.:|||||.....|:.||||.::.|....:.|. .:|.||.
plant   237 ALGAAKGLAFLHEEAEKPVIYRDFKTSNILLDGEYNAKLSDFGLAKDAPDEKKSHVS-TRVMGTY 300

  Fly   389 IYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYV------KQQWRQN 447
            .|..||:.....|:|..||||||:||||:.|||:..|:...| .::||:::|      |:::.:.
plant   301 GYAAPEYVMTGHLTTKSDVYSFGVVLLEILTGRRSVDKSRPN-GEQNLVEWVRPHLLDKKRFYRL 364

  Fly   448 RMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFEP 497
            ....||.|.:....::      |.:....|...|.:.||.|:.|::..:|
plant   365 LDPRLEGHYSIKGAQK------ATQVAAQCLNRDSKARPKMSEVVEALKP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 99/297 (33%)
TyrKc 219..495 CDD:197581 98/293 (33%)
AT3G28690NP_001030790.3 STKc_IRAK 132..409 CDD:270968 99/297 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.