DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G26700

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001327329.1 Gene:AT3G26700 / 822282 AraportID:AT3G26700 Length:380 Species:Arabidopsis thaliana


Alignment Length:348 Identity:106/348 - (30%)
Similarity:175/348 - (50%) Gaps:49/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYR 229
            |.:|||.|.:.: ||.:...|:.|....|.|.   ..:..||..||..::..:.:|.|.||:||:
plant    35 NLSRTSETGSSD-PSTQEGRNVAIELSMREAR---RFEMEELAQATKSFTNKSLIGIGKFGEVYK 95

  Fly   230 GKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQL 293
            |..:. :.||||    :.|.:     ..|:..||::||:||.|.|::.|.|:..:.....|||:.
plant    96 GLLQDGVLVAIK----KRPGL-----PTQEFVNEVRYLSSIHHRNLVTLLGFCQESNTQFLVYEY 151

  Fly   294 MKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTP-LIHGDIKPANILLDQC 357
            :..||:.:.|.....:.|...|.::.|.:||:|.|:|:..||:.  :| |||.|.|.||:|:|:.
plant   152 VPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSL--SPRLIHKDFKTANVLVDEN 214

  Fly   358 LQPKIGDFG----LVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVF 418
            ...|:.|.|    |.||.      |...:.:...:|:|.||.:.|::.|...|||:||:.|||:.
plant   215 FIAKVADAGVRNFLGRED------VGTSSHIVADQIFLSPEVQEFKRFSEKSDVYAFGVFLLELV 273

  Fly   419 TGRQVTDRVPENETKKNLLDYVKQQWRQNRME------LLEKHL----AAPMGKELDMCMCAIEA 473
            :||:.::..|.:.| :.|:|     |.||..:      ::::.|    .|...:||      |..
plant   274 SGREASEPSPSSST-QTLVD-----WMQNLTDYADIPMMIDERLGGTYTAEGVEEL------ITL 326

  Fly   474 GLHCTALDPQDRPSMNAVLKRFE 496
            .|.|..:..:.||:|:.|:...|
plant   327 TLRCVDVSSEKRPTMSFVVTELE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/294 (31%)
TyrKc 219..495 CDD:197581 90/291 (31%)
AT3G26700NP_001327329.1 PKc_like 85..351 CDD:419665 91/294 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.