DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G24790

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001326412.1 Gene:AT3G24790 / 822077 AraportID:AT3G24790 Length:381 Species:Arabidopsis thaliana


Alignment Length:368 Identity:116/368 - (31%)
Similarity:173/368 - (47%) Gaps:60/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SAKV--NNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELEN 208
            |:||  |.|...|:.....||....|.....:......:.....|.|            :.||..
plant     8 SSKVLDNEGSSMPAPYKQPNSPKRTTGEVVAKNANGPSNNMGARIFT------------FRELAT 60

  Fly   209 ATDGWSPDNRLGQGGFGDVYRGKWK---QLDVAIKVMNYRSPNIDQKMVELQQSY-NELKYLNSI 269
            ||..:..:..:|:||||.||:||.:   |: ||:|       .:|:..::.|:.: .|:..|:.:
plant    61 ATKNFRQECLIGEGGFGRVYKGKLENPAQV-VAVK-------QLDRNGLQGQREFLVEVLMLSLL 117

  Fly   270 RHDNILALYGYSIKGGKPCLVYQLMKGGSLEAR-LRAHKAQNPLPALTWQQRFSISLGTARGIYF 333
            .|.|::.|.||...|.:..|||:.|..||||.. |.....|.|   |.|..|..|:||.|:||.:
plant   118 HHRNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLLDLEPGQKP---LDWNTRIKIALGAAKGIEY 179

  Fly   334 LHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNF 398
            ||.....|:|:.|:|.:|||||.....|:.||||.:.||.. |.:...::|.||..|..||::..
plant   180 LHDEADPPVIYRDLKSSNILLDPEYVAKLSDFGLAKLGPVG-DTLHVSSRVMGTYGYCAPEYQRT 243

  Fly   399 RQLSTGVDVYSFGIVLLEVFTGRQVTDRV-PENETKKNLLDYV-------KQQWRQNRMELLEKH 455
            ..|:...||||||:||||:.:||:|.|.: |.:|  :||:.:.       .:.|:          
plant   244 GYLTNKSDVYSFGVVLLELISGRRVIDTMRPSHE--QNLVTWALPIFRDPTRYWQ---------- 296

  Fly   456 LAAPM------GKELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            ||.|:      .|.|:.   ||.....|...:|..||.|:.|:
plant   297 LADPLLRGDYPEKSLNQ---AIAVAAMCLHEEPTVRPLMSDVI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 101/293 (34%)
TyrKc 219..495 CDD:197581 101/293 (34%)
AT3G24790NP_001326412.1 STKc_IRAK 71..339 CDD:270968 101/293 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.