DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CERK1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_566689.2 Gene:CERK1 / 821717 AraportID:AT3G21630 Length:617 Species:Arabidopsis thaliana


Alignment Length:363 Identity:113/363 - (31%)
Similarity:179/363 - (49%) Gaps:57/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NNGPPFPSSSGVSNSNNNRTSTTATEEIPSLES--LGNIHIS------TVQRAAESLLEIDYAEL 206
            :.|..|.||..:|...::.:||       ||:|  ||...:|      :|.::.|..||    ||
plant   262 SKGDSFSSSIPLSTKADHASST-------SLQSGGLGGAGVSPGIAAISVDKSVEFSLE----EL 315

  Fly   207 ENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRH 271
            ..|||.::...::||||||.||..:.:....|||.|:         |...:|...|||.|..:.|
plant   316 AKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMD---------MEASKQFLAELKVLTRVHH 371

  Fly   272 DNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHT 336
            .|::.|.||.::|.. .|||:.::.|:|...|.. ..:.|||   |.:|..|:|.:|||:.::|.
plant   372 VNLVRLIGYCVEGSL-FLVYEYVENGNLGQHLHG-SGREPLP---WTKRVQIALDSARGLEYIHE 431

  Fly   337 ARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEV-----NKVFGTKIYLPPEFR 396
            ......:|.|||.||||:||..:.|:.||||.:        :.||     ....||..|:.|| .
plant   432 HTVPVYVHRDIKSANILIDQKFRAKVADFGLTK--------LTEVGGSATRGAMGTFGYMAPE-T 487

  Fly   397 NFRQLSTGVDVYSFGIVLLEVFTGR----QVTDRVPENETKKNLLDYVKQQWRQ-NRMELLEKHL 456
            .:.::|..||||:||:||.|:.:.:    ::|:.|.|   .:.|:...::.::: ::.|.|.|.:
plant   488 VYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGE---FRGLVGVFEESFKETDKEEALRKII 549

  Fly   457 AAPMGKE--LDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            ...:|..  .|......|.|..||..:.|.||||..::
plant   550 DPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIV 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/286 (32%)
TyrKc 219..495 CDD:197581 91/286 (32%)
CERK1NP_566689.2 mltD <104..202 CDD:182727
PKc_like 328..587 CDD:419665 91/284 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.