DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G09830

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001326011.1 Gene:AT3G09830 / 820141 AraportID:AT3G09830 Length:418 Species:Arabidopsis thaliana


Alignment Length:356 Identity:108/356 - (30%)
Similarity:169/356 - (47%) Gaps:41/356 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SNSNNNRTSTTATEEIPSLESLGNIH-ISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFG 225
            |..|:...|.|:||     .|:|..: ...|...|.:|.|....:|::||..:|....:|:||||
plant    37 SEFNSRDVSGTSTE-----SSMGRKNSYPPVSTRASNLREFSITDLKSATKNFSRSVMIGEGGFG 96

  Fly   226 DVYRGKWKQL-------DVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSI- 282
            .|:||..:.|       :||:|.:..|.....::.|      .|:.:|..:.|.|::.|.||.. 
plant    97 CVFRGTVRNLEDSSVKIEVAVKQLGKRGLQGHKEWV------TEVNFLGIVEHTNLVKLLGYCAE 155

  Fly   283 ---KGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIH 344
               :|.:..|||:.|...|:|    .|.:...|..|||..|..|:...|||:.:||......:|.
plant   156 DDERGIQRLLVYEYMPNRSVE----FHLSPRSLTVLTWDLRLRIAQDAARGLTYLHEEMEFQIIF 216

  Fly   345 GDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPEFRNFRQLSTGVDVY 408
            .|.|.:|||||:..:.|:.||||.|.||.  :.:..|: .|.||..|..||:....:|::..||:
plant   217 RDFKSSNILLDEDWKAKLSDFGLARLGPS--EGLTHVSTDVVGTMGYAAPEYIQTGRLTSKSDVW 279

  Fly   409 SFGIVLLEVFTGRQVTDR-VPENETKKNLLDYVKQQWRQNR--MELLEKHLAA--PMGKELDMCM 468
            .:|:.|.|:.|||:..|| .|:.|.|  ||::|:......|  ..:|:..|..  |:.....:.:
plant   280 GYGVFLYELITGRRPVDRNRPKGEQK--LLEWVRPYLSDTRKFKLILDPRLEGKYPIKSVQKLAV 342

  Fly   469 CAIEAGLHCTALDPQDRPSMNAVLKRFEPFV 499
            .|    ..|...:.:.||.|:.||:.....|
plant   343 VA----NRCLVRNSKARPKMSEVLEMVNKIV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/295 (31%)
TyrKc 219..495 CDD:197581 91/292 (31%)
AT3G09830NP_001326011.1 STKc_IRAK 90..368 CDD:270968 91/295 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.010

Return to query results.
Submit another query.