DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G08870

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001327766.1 Gene:AT3G08870 / 820035 AraportID:AT3G08870 Length:714 Species:Arabidopsis thaliana


Alignment Length:362 Identity:103/362 - (28%)
Similarity:172/362 - (47%) Gaps:34/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQR---AAESLL---EID---- 202
            :::..||.|..|.....|:..........|.:|..|..:.|..:.:   ..|..|   |||    
plant   312 EISRLPPPPRLSNKKGYNSQVIVLIVALSIVTLVLLVLLFIFVMYKRRIQEEDTLEDWEIDYPHR 376

  Fly   203 --YAELENATDGWSPDNRLGQGGFGDVYRGKWKQL-DVAIKVMNYRSPNIDQKMVELQQSYNELK 264
              |.:|..||..:.....:|.||||.||||..... .:|:|.:...|      :..:::...|::
plant   377 FRYRDLYLATKKFKESEIIGTGGFGIVYRGNLSSSGPIAVKKITSNS------LQGVREFMAEIE 435

  Fly   265 YLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTAR 329
            .|..:.|.|::.|.|:.....:..|:|..:..|||::.|.....:|.: .|.|..||.|..|.|.
plant   436 SLGRLGHKNLVNLQGWCKHKNELLLIYDYIPNGSLDSLLYQTPRRNGI-VLPWDVRFEIIKGIAS 499

  Fly   330 GIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPE 394
            |:.:||......::|.|:||:|:|:|:.:..|:|||||.|...:.  .:.:..|:.||..|:.||
plant   500 GLLYLHEEWEQIVVHRDVKPSNVLIDEDMNAKLGDFGLARLYERG--TLTQTTKIVGTLGYMAPE 562

  Fly   395 FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR--MELLEKHLA 457
            .....:.||..||::||::|||:..|.:     |.|.....|.|:| .::..|.  :.:::::|.
plant   563 LTRNGKGSTASDVFAFGVLLLEIVCGNK-----PTNAENFFLADWV-MEFHTNGGILCVVDQNLG 621

  Fly   458 APM-GKELDMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
            :.. |:|..:   |:..||.|....|:.||||..||:
plant   622 SSFNGREAKL---ALVVGLLCCHQKPKFRPSMRMVLR 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 85/279 (30%)
TyrKc 219..495 CDD:197581 85/279 (30%)
AT3G08870NP_001327766.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.