DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RKF3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_182322.1 Gene:RKF3 / 819413 AraportID:AT2G48010 Length:617 Species:Arabidopsis thaliana


Alignment Length:342 Identity:109/342 - (31%)
Similarity:170/342 - (49%) Gaps:57/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVM 242
            |||:.....:.::..:. :|::..:.|::.||:.:|..|.:|:||:|:|::|.... ..||.|..
plant   250 SLEAGTQSRLDSMSEST-TLVKFSFDEIKKATNNFSRHNIIGRGGYGNVFKGALPDGTQVAFKRF 313

  Fly   243 NYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGY-----SIKGGKPCLVYQLMKGGSLEAR 302
            ...|...|....      :|::.:.||||.|:|||.||     ..:|.:..:|..|:..|||...
plant   314 KNCSAGGDANFA------HEVEVIASIRHVNLLALRGYCTATTPYEGHQRIIVCDLVSNGSLHDH 372

  Fly   303 LRAH-KAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFG 366
            |... :||     |.|..|..|:||.|||:.:||......:||.|||.:|||||:..:.|:.|||
plant   373 LFGDLEAQ-----LAWPLRQRIALGMARGLAYLHYGAQPSIIHRDIKASNILLDERFEAKVADFG 432

  Fly   367 LVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQ--VTDR--- 426
            |.:..|:.:..:  ..:|.||..|:.||:..:.||:...||||||:||||:.:.|:  |||.   
plant   433 LAKFNPEGMTHM--STRVAGTMGYVAPEYALYGQLTEKSDVYSFGVVLLELLSRRKAIVTDEEGQ 495

  Fly   427 -----------VPENETKKNLLDYVKQQW-RQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTA 479
                       |.|.:|    ||.|:... .:...|:|||::       |...:|: ...||.  
plant   496 PVSVADWAWSLVREGQT----LDVVEDGMPEKGPPEVLEKYV-------LIAVLCS-HPQLHA-- 546

  Fly   480 LDPQDRPSMNAVLKRFE 496
                 ||:|:.|:|..|
plant   547 -----RPTMDQVVKMLE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/302 (33%)
TyrKc 219..495 CDD:197581 99/299 (33%)
RKF3NP_182322.1 SPARK 19..168 CDD:408930
STKc_IRAK 289..558 CDD:270968 99/300 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.