DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PTI1-4

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001031553.1 Gene:PTI1-4 / 819320 AraportID:AT2G47060 Length:397 Species:Arabidopsis thaliana


Alignment Length:417 Identity:120/417 - (28%)
Similarity:185/417 - (44%) Gaps:82/417 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIH 187
            :|:||              ..|...:.|....||..   :::.:::.|.|| ::.|.:..|..|.
plant    11 DDMHK--------------TADYGGRHNQAKHFPPG---NDARHHQASETA-QKGPPVVKLQPIE 57

  Fly   188 ISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQK 252
            :..          |.::||:.|||.:..::.:|:|.:|.||.|          |:|...|:..:|
plant    58 VPI----------IPFSELKEATDDFGSNSLIGEGSYGRVYYG----------VLNNDLPSAIKK 102

  Fly   253 MVELQQSYNE----LKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAH---KAQN 310
            :...:|..||    :..::.::|||.:.|.||.:.|....|.|:....|||...|...   |...
plant   103 LDSNKQPDNEFLAQVSMVSRLKHDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKGAQ 167

  Fly   311 PLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSL 375
            |.|.|:|.||..|::|.|||:.:||......:||.|||.:|:||.:....||.||.|..:.| .:
plant   168 PGPVLSWYQRVKIAVGAARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQAP-DM 231

  Fly   376 DAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENE-------T 432
            .|.:...:|.||..|..||:....||:...||||||:||||:.|||:..| |:|..:       |
plant   232 AARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWAT 296

  Fly   433 KKNLLDYVKQ--------------------QWRQN-----RMELLEKHLAAPMGKELDMCMCAIE 472
            .|...|.|||                    |...|     |..|....|.:..|.: |..:.|:.
plant   297 PKLSEDKVKQCVDARLGGDYPPKAVAKVRNQTFHNLRLCLRFRLHSLFLTSSYGDD-DSQLAAVA 360

  Fly   473 AGLHCTALDPQDRPSMNAVLKRFEPFV 499
            |  .|...:...||:|:.|:|..:|.:
plant   361 A--LCVQYEADFRPNMSIVVKALQPLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 2/4 (50%)
STKc_IRAK 219..498 CDD:270968 100/318 (31%)
TyrKc 219..495 CDD:197581 100/315 (32%)
PTI1-4NP_001031553.1 STKc_IRAK 79..384 CDD:270968 100/318 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.010

Return to query results.
Submit another query.