DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G42960

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001318408.1 Gene:AT2G42960 / 818898 AraportID:AT2G42960 Length:494 Species:Arabidopsis thaliana


Alignment Length:332 Identity:113/332 - (34%)
Similarity:168/332 - (50%) Gaps:39/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW-KQLDVAI- 239
            :|.:..||..|..|::            :||.||:.::|.|.||:||:|.|||||. ...:||: 
plant   159 LPEISHLGWGHWFTLR------------DLELATNRFAPVNVLGEGGYGVVYRGKLVNGTEVAVK 211

  Fly   240 KVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLR 304
            |::|    |:.|...|.:.   |::.:..:||.|::.|.||.|:|....|||:.:..|:||..| 
plant   212 KLLN----NLGQAEKEFRV---EVEAIGHVRHKNLVRLLGYCIEGVHRMLVYEYVNSGNLEQWL- 268

  Fly   305 AHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR 369
             |.|......|||:.|..|..|||:.:.:||.|....::|.|||.:|||:|.....|:.||||. 
plant   269 -HGAMRQHGNLTWEARMKIITGTAQALAYLHEAIEPKVVHRDIKASNILIDDEFNAKLSDFGLA- 331

  Fly   370 EGPKSLDAVVE--VNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENE 431
               |.||:...  ..:|.||..|:.||:.|...|:...|:||||::|||..|||...| ..|.||
plant   332 ---KLLDSGESHITTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVLLLEAITGRDPVDYGRPANE 393

  Fly   432 TKKNLLDYVKQQWRQNRM-ELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRF 495
            .  ||::::|......|. |:::..|.....|  .....|:...|.|...:.:.||.|:.|.:..
plant   394 V--NLVEWLKMMVGTRRAEEVVDPRLEPRPSK--SALKRALLVSLRCVDPEAEKRPRMSQVARML 454

  Fly   496 E----PF 498
            |    ||
plant   455 ESDEHPF 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/288 (35%)
TyrKc 219..495 CDD:197581 99/281 (35%)
AT2G42960NP_001318408.1 STKc_IRAK 189..455 CDD:270968 99/282 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.010

Return to query results.
Submit another query.