DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G28940

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_973556.1 Gene:AT2G28940 / 817443 AraportID:AT2G28940 Length:462 Species:Arabidopsis thaliana


Alignment Length:310 Identity:105/310 - (33%)
Similarity:155/310 - (50%) Gaps:37/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRGKW---------KQLDVAIKVMNYRSPNIDQKMVELQQ 258
            :.||:.||.|::....:|:||||.||||..         .:::||:|.:|      .|.:...::
plant    92 FKELKIATKGFNRGLLIGEGGFGCVYRGVVDVSDSNGFDSKINVAVKQLN------RQGLQGHKE 150

  Fly   259 SYNELKYLNSIRHDNILALYGYSI----KGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQ 319
            ..||:.:|..:.|.|::.|.||..    :|.:..|||:||...|||..|........||   |..
plant   151 WINEVNFLGVVNHPNLVKLVGYCADDDERGMQRLLVYELMCNKSLEDHLVGRVVSVSLP---WMM 212

  Fly   320 RFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREG-PKSLDAVVEVNK 383
            |..|:...|:|:.:||......||..|.|.:|||||:....|:.||||.|:| |:.|..|  ...
plant   213 RLKIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHV--STS 275

  Fly   384 VFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDR-VPENETKKNLLDYVKQQWRQN 447
            |.||..|..||:....:|:...||:|||:||.|:.|||:..|| .|..|.|  ||::||.....:
plant   276 VVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQK--LLEWVKPYVSDS 338

  Fly   448 RMELLEKHLAA-PMGKELDMCMCAIE--AGL--HCTALDPQDRPSMNAVL 492
            :    :.||.. |..:....||.:::  |.|  .|....|:.||.|:.|:
plant   339 K----KFHLIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPKMSEVV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/294 (34%)
TyrKc 219..495 CDD:197581 100/294 (34%)
AT2G28940NP_973556.1 STKc_IRAK 108..390 CDD:270968 100/294 (34%)
Pkinase_Tyr 108..387 CDD:285015 100/294 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.