DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G28590

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_180426.1 Gene:AT2G28590 / 817407 AraportID:AT2G28590 Length:424 Species:Arabidopsis thaliana


Alignment Length:314 Identity:97/314 - (30%)
Similarity:164/314 - (52%) Gaps:27/314 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 NIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD--VAIKVMNYRSP 247
            |:....:.:.|::   ..:.||..:|..:..|..||:||||.||:|..::::  ||||       
plant    73 NVEDEVIVKKAQT---FTFEELSVSTGNFKSDCFLGEGGFGKVYKGFIEKINQVVAIK------- 127

  Fly   248 NIDQKMVE-LQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLR-AHKAQN 310
            .:|:...: :::...|:..|:...|.|::.|.|:..:|.:..|||:.|..|||:..|. ....:|
plant   128 QLDRNGAQGIREFVVEVLTLSLADHPNLVKLIGFCAEGVQRLLVYEYMPLGSLDNHLHDLPSGKN 192

  Fly   311 PLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSL 375
            |   |.|..|..|:.|.|||:.:||.....|:|:.|:|.:|||:|:....|:.||||.:.||:..
plant   193 P---LAWNTRMKIAAGAARGLEYLHDTMKPPVIYRDLKCSNILIDEGYHAKLSDFGLAKVGPRGS 254

  Fly   376 DAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYV 440
            :..|. .:|.||..|..|::....||:...||||||:||||:.|||:..|.. .....::|:::.
plant   255 ETHVS-TRVMGTYGYCAPDYALTGQLTFKSDVYSFGVVLLELITGRKAYDNT-RTRNHQSLVEWA 317

  Fly   441 KQQW--RQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            ...:  |:|..::::..|      |.|..:..:...|...|:..|::|||..|:
plant   318 NPLFKDRKNFKKMVDPLL------EGDYPVRGLYQALAIAAMCVQEQPSMRPVI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/280 (33%)
TyrKc 219..495 CDD:197581 91/280 (33%)
AT2G28590NP_180426.1 STKc_IRAK 104..369 CDD:270968 91/280 (33%)
STYKc 104..369 CDD:214568 91/280 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.