DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G26730

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_180241.1 Gene:AT2G26730 / 817214 AraportID:AT2G26730 Length:658 Species:Arabidopsis thaliana


Alignment Length:367 Identity:91/367 - (24%)
Similarity:150/367 - (40%) Gaps:80/367 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPFPSSSGVSNSNNNRTSTTA-----TEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDG 212
            ||     |.|:|....|.|::     ||....:.:.|.::...::....:..|:           
plant   308 PP-----GASSSKEEVTGTSSGMGGETERNKLVFTEGGVYSFDLEDLLRASAEV----------- 356

  Fly   213 WSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILA 276
                  ||:|..|..|:...:: ..|.:|       .:...|...::...:::.:..|:|.|::.
plant   357 ------LGKGSVGTSYKAVLEEGTTVVVK-------RLKDVMASKKEFETQMEVVGKIKHPNVIP 408

  Fly   277 LYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTP 341
            |..|.....:..||:..|..|||.|.|...:.....| |.|..|..|::..|||:..||.:  ..
plant   409 LRAYYYSKDEKLLVFDFMPTGSLSALLHGSRGSGRTP-LDWDNRMRIAITAARGLAHLHVS--AK 470

  Fly   342 LIHGDIKPANILL----DQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKI-------YLPPEF 395
            |:||:||.:||||    |.|    :.|:||              |::|....       |..||.
plant   471 LVHGNIKASNILLHPNQDTC----VSDYGL--------------NQLFSNSSPPNRLAGYHAPEV 517

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENE---TKKNLLDYVKQQWRQN--RMELLEKH 455
            ...|:::...||||||::|||:.||:.........|   ..:.:|..|:::|...  .:||:..|
plant   518 LETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYH 582

  Fly   456 -LAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
             :...|.:.|.:.|.       |.:..|..||.|..||:..|
plant   583 NIEEEMVQLLQIAMA-------CVSTVPDQRPVMQEVLRMIE 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 80/296 (27%)
TyrKc 219..495 CDD:197581 79/293 (27%)
AT2G26730NP_180241.1 LRRNT_2 28..62 CDD:400522
PLN00113 <67..625 CDD:215061 91/367 (25%)
leucine-rich repeat 68..92 CDD:275380
leucine-rich repeat 93..116 CDD:275380
leucine-rich repeat 117..140 CDD:275380
leucine-rich repeat 141..164 CDD:275380
leucine-rich repeat 165..186 CDD:275380
STKc_IRAK 357..617 CDD:270968 79/294 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.