DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G25220

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001189598.1 Gene:AT2G25220 / 817060 AraportID:AT2G25220 Length:437 Species:Arabidopsis thaliana


Alignment Length:389 Identity:119/389 - (30%)
Similarity:183/389 - (47%) Gaps:72/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SSAKVNNGPPFPSSSGVSN----------SNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLL 199
            |...:||...|.|:..:.|          |:|:.:..:.:..:..|.|:.....:::|:......
plant    75 SPKSINNSGTFISNERICNKFQSLYVFNGSSNSESGNSFSLLMRRLGSIKTQRRTSIQKGYVQFF 139

  Fly   200 EIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSY-NEL 263
            :|  ..||.||.|:...:.:||||||.||:|   .||..:|....:..|:.|   |.::.: ||:
plant   140 DI--KTLEKATGGFKESSVIGQGGFGCVYKG---CLDNNVKAAVKKIENVSQ---EAKREFQNEV 196

  Fly   264 KYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTA 328
            ..|:.|.|.|:::|.|.:.:.....:||:||:.|||:.:|......:   ||||..|..|:|.||
plant   197 DLLSKIHHSNVISLLGSASEINSSFIVYELMEKGSLDEQLHGPSRGS---ALTWHMRMKIALDTA 258

  Fly   329 RGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLP 392
            ||:.:||.....|:||.|:|.:|||||.....||.||||.    .|||...:.| |:.||..|:.
plant   259 RGLEYLHEHCRPPVIHRDLKSSNILLDSSFNAKISDFGLA----VSLDEHGKNNIKLSGTLGYVA 319

  Fly   393 PEFRNFRQLSTGVDVYSFGIVLLEVFTGR--------------------QVTDR--VPENETKKN 435
            ||:....:|:...|||:||:||||:..||                    |:|||  :|      |
plant   320 PEYLLDGKLTDKSDVYAFGVVLLELLLGRRPVEKLTPAQCQSLVTWAMPQLTDRSKLP------N 378

  Fly   436 LLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFEPFV 499
            ::|.|    .::.|:|...:..|.|             .:.|...:|..||.:..||....|.|
plant   379 IVDAV----IKDTMDLKHLYQVAAM-------------AVLCVQPEPSYRPLITDVLHSLVPLV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/302 (33%)
TyrKc 219..495 CDD:197581 100/299 (33%)
AT2G25220NP_001189598.1 Pkinase 151..420 CDD:278497 100/304 (33%)
PKc_like 157..424 CDD:304357 100/302 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.