DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G23450

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_565552.1 Gene:AT2G23450 / 816877 AraportID:AT2G23450 Length:708 Species:Arabidopsis thaliana


Alignment Length:341 Identity:112/341 - (32%)
Similarity:152/341 - (44%) Gaps:67/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HISTVQRAAE-----SLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGK-----WKQLDVAIKV 241
            |:|..:..:|     |:....|.|:|.||||:|...:||.|.:|.|||||     |    ||||.
plant   317 HLSAKRLLSEAAGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQNDEW----VAIKR 377

  Fly   242 MNYR-SPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRA 305
            :.:| |.::||.|       ||:|.|:|:.|.|::.|.|..|:.|.|.|||:.|..|:|...|:.
plant   378 LRHRDSESLDQVM-------NEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQR 435

  Fly   306 HKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVRE 370
            .:..    .|.|..|.:::..||:.|.:||::...|:.|.|||..|||||.....|:.||||.|.
plant   436 DRGS----GLPWTLRLTVATQTAKAIAYLHSSMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRL 496

  Fly   371 GPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKN 435
            |......:....:  ||..||.|::.....||...||||||:||.|:.||.:|.| .....|:.|
plant   497 GMTESSHISTAPQ--GTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVD-FTRPHTEIN 558

  Fly   436 L--------------------LDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTAL 480
            |                    ||.....|     .|...|..|             |....|.|.
plant   559 LAALAVDKIGSGCIDEIIDPILDLDLDAW-----TLSSIHTVA-------------ELAFRCLAF 605

  Fly   481 DPQDRPSMNAVLKRFE 496
            ....||:|..|....|
plant   606 HSDMRPTMTEVADELE 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/304 (33%)
TyrKc 219..495 CDD:197581 99/301 (33%)
AT2G23450NP_565552.1 S_TKc 348..616 CDD:214567 99/303 (33%)
STKc_IRAK 354..623 CDD:270968 100/304 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.